BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g22f (609 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 1.9 AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal... 24 3.3 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 3.3 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 25.0 bits (52), Expect = 1.9 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +3 Query: 222 MECEQFCLCTFETNWASQIM 281 MEC + C C + +W+S ++ Sbjct: 756 MECPKQCTCYHDQSWSSNVV 775 >AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 131 Score = 24.2 bits (50), Expect = 3.3 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 359 WLGRFRTIFYLSLVY-ATGSVLISLTAMPPIGLPQFEL 469 W+ + +L + TG VLISL +P + LP+ ++ Sbjct: 79 WIQNITDLNFLQHIREVTGYVLISLYDLPQVILPRLQI 116 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.2 bits (50), Expect = 3.3 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 359 WLGRFRTIFYLSLVY-ATGSVLISLTAMPPIGLPQFEL 469 W+ + +L + TG VLISL +P + LP+ ++ Sbjct: 39 WIQNITDLNFLQHIREVTGYVLISLYDLPQVILPRLQI 76 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 590,680 Number of Sequences: 2352 Number of extensions: 10390 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -