BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g21f (524 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6677| Best HMM Match : Ribosomal_L1 (HMM E-Value=0.4) 76 2e-14 SB_41172| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-21) 31 0.44 SB_11654| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_45986| Best HMM Match : Extensin_2 (HMM E-Value=0.12) 28 5.4 SB_29852| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_11653| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_11926| Best HMM Match : UPAR_LY6 (HMM E-Value=0.0022) 27 9.5 SB_3212| Best HMM Match : APC10 (HMM E-Value=0.36) 27 9.5 >SB_6677| Best HMM Match : Ribosomal_L1 (HMM E-Value=0.4) Length = 81 Score = 75.8 bits (178), Expect = 2e-14 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = +2 Query: 386 SESLIKQIPRLLGPGLNKAGKFPGLLSHQESMTQKIDEVKGTIKFQ 523 S+SLIKQIPR+LGPGLNKAGKFP ++H E+M QKI++V+ TIKFQ Sbjct: 28 SDSLIKQIPRILGPGLNKAGKFPTPINHNENMVQKIEDVRSTIKFQ 73 >SB_41172| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-21) Length = 342 Score = 31.5 bits (68), Expect = 0.44 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 18/114 (15%) Frame = -2 Query: 322 FQSLSIHTWHIQGFSLVTMLLVSKNA----NLHFRPRYVF*LYSAGETLVLLWVIVLQTN 155 + S + TW + S +T+ +S LH R + +F + A L+++W+I L N Sbjct: 100 YMSFELSTWLLLMSSFLTLTAISCERFAALTLHLRYQQMFTMKRAAMALIMIWLISLSLN 159 Query: 154 -LKLYSLQKVTF----------LVLRGLKNGIHALVERVTRH---FRRHFVCQR 35 ++L L+ + + LVL L N + L++ V RH R H V QR Sbjct: 160 VIRLLLLESLFWCITLTTVSICLVLILLTN--YVLIKAVQRHRKLIRSHQVVQR 211 >SB_11654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1161 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = -2 Query: 298 WHIQGFSLVTMLLVSKNANLHFRPRYVF*LYSAGETLVLLWVIVLQTNLKLYSLQKVTFL 119 W I LV L+ + N + R ++VF + E L+ +W + +T L +Q F+ Sbjct: 296 WFIWTAVLVDALIQANNGSWRRRAQFVFTILFDIEALIKIWCVGFRTYLNSSRMQFFEFI 355 Query: 118 V 116 + Sbjct: 356 L 356 >SB_45986| Best HMM Match : Extensin_2 (HMM E-Value=0.12) Length = 1243 Score = 27.9 bits (59), Expect = 5.4 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +2 Query: 149 LQIGLKNYDPQKDKRFSGTVKLKYIPRPKM-QVC---VLGDQQHC 271 LQ G K YDP K+K K KY+ PK+ + C ++ +QHC Sbjct: 336 LQCGKKFYDPLKEK----CAKNKYVYNPKIYKYCYGRIIPVKQHC 376 >SB_29852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 836 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -2 Query: 103 KNGIHALVERVTRHFRRHFVCQRTTYH 23 K G+H ++ +VT + RRH++ + T H Sbjct: 284 KKGVHMILGQVTGNARRHYIPKFTANH 310 >SB_11653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1867 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/64 (25%), Positives = 30/64 (46%) Frame = -2 Query: 298 WHIQGFSLVTMLLVSKNANLHFRPRYVF*LYSAGETLVLLWVIVLQTNLKLYSLQKVTFL 119 W I LV L+ + N + + ++VF + E L+ +W + +T L +Q F+ Sbjct: 395 WFIWFAVLVDALIQANNGSWRRQAQFVFTILFDIEALIKIWCVGFRTYLNSSRMQFFEFI 454 Query: 118 VLRG 107 + G Sbjct: 455 LAVG 458 >SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 403 ADSPFVGSRFEQSW*IPWSSLPPGVHDAED 492 +DSP+ G+ + W I S+ P VHD D Sbjct: 725 SDSPYSGNSSGEDWDIYSSAQPTAVHDLPD 754 >SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 27.9 bits (59), Expect = 5.4 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +2 Query: 149 LQIGLKNYDPQKDKRFSGTVKLKYIPRPKM-QVC---VLGDQQHC 271 LQ G K YDP K+K K KY+ PK+ + C ++ +QHC Sbjct: 336 LQCGKKFYDPLKEK----CAKNKYVYNPKIYKYCYGRIIPVKQHC 376 >SB_11926| Best HMM Match : UPAR_LY6 (HMM E-Value=0.0022) Length = 190 Score = 27.1 bits (57), Expect = 9.5 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -2 Query: 322 FQSLSIHTWHIQGFSLVTMLLVSKNANL 239 +Q LS+H +H+ G ++ M + KN + Sbjct: 37 YQQLSVHAYHLFGLPVLRMHVTQKNMKI 64 >SB_3212| Best HMM Match : APC10 (HMM E-Value=0.36) Length = 646 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 92 NAVLQSSKDKKRNFLETVELQIGLKNYD 175 +A L+SS+DK R LE IGL N D Sbjct: 164 DAALKSSEDKHRKKLEEAISNIGLTNTD 191 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,435,931 Number of Sequences: 59808 Number of extensions: 313001 Number of successful extensions: 668 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 668 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1184975377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -