BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g18r (804 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 27 0.90 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 25 2.7 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 6.3 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 26.6 bits (56), Expect = 0.90 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 4/56 (7%) Frame = -1 Query: 225 VDLSNQQLTSNIFPSLIV-LQHCKKLSLENNNLTTMKN--FPDL-DLVELNLLGNE 70 ++LS +LT N+ P L +H K++ L+NN+L + F DL L+ L+L NE Sbjct: 263 LELSLNRLT-NLPPELFSEAKHIKEIYLQNNSLNVLAPGIFSDLKQLLVLDLSNNE 317 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 25.0 bits (52), Expect = 2.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 498 PNSTVVYKTLVGPLTLL*QPPNNFA 572 P Y L GP +LL +PPN+ A Sbjct: 19 PTELTQYDLLFGPGSLLYRPPNSMA 43 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 711 STRHHNNFLYTKPIRHLHHN 770 ST NF Y P H HHN Sbjct: 1389 STTSTTNFSYQHPHPHHHHN 1408 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 828,734 Number of Sequences: 2352 Number of extensions: 17513 Number of successful extensions: 41 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -