BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g18f (608 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF100664-1|AAC68985.1| 580|Caenorhabditis elegans Hypothetical ... 51 6e-07 Z77662-5|CAB01192.2| 579|Caenorhabditis elegans Hypothetical pr... 28 4.5 >AF100664-1|AAC68985.1| 580|Caenorhabditis elegans Hypothetical protein M57.2 protein. Length = 580 Score = 51.2 bits (117), Expect = 6e-07 Identities = 24/52 (46%), Positives = 31/52 (59%) Frame = +3 Query: 426 FKHAMQKIQIKRKECTLDKELLELTGNVLSSNPDIYTLWNIRRDILQLFKKA 581 F H KI KR++ D E+L LT +L N DIYT WNIRR ++L +A Sbjct: 28 FLHVRDKIVAKREKGEYDDEILSLTQAILEKNADIYTFWNIRRTTIELRMEA 79 >Z77662-5|CAB01192.2| 579|Caenorhabditis elegans Hypothetical protein F47B8.5 protein. Length = 579 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 501 LSVPVILYQECILFS*FEFFAWHV*KSSIFHF 406 L+ P I+++ LFS F FF + +S FHF Sbjct: 303 LTKPAIIFEAICLFSLFSFFNFITFSTSHFHF 334 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,909,650 Number of Sequences: 27780 Number of extensions: 218068 Number of successful extensions: 390 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1311096392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -