BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g13f (645 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 23 2.2 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 2.8 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 2.8 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 3.8 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.7 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +2 Query: 377 LPSTEQLRSRQCLDAQPPREPQPWEE 454 LP+ E R + A P++P WE+ Sbjct: 30 LPTVEPGYLRPLIPATAPQKPDKWED 55 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = +2 Query: 533 VCSGHRGIQEMDLERDPGGIAIFPHGHWLRGT 628 VC G + + +++ + + + HG W RG+ Sbjct: 178 VCEGDKVVIDVENHIEGNEVTLHWHGVWQRGS 209 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = +2 Query: 533 VCSGHRGIQEMDLERDPGGIAIFPHGHWLRGT 628 VC G + + +++ + + + HG W RG+ Sbjct: 178 VCEGDKVVIDVENHIEGNEVTLHWHGVWQRGS 209 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 549 RCPEHTIDYCRRCN 508 R E TID C RC+ Sbjct: 226 RSDEQTIDICMRCH 239 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 420 LNRHGNRNPGKSVTVSVKEIADLKDEIINSYNA 518 LNR + NP + +I +L+ E I S +A Sbjct: 499 LNRRRDENPRNYRSDEGPQITELEPETIESQDA 531 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 420 LNRHGNRNPGKSVTVSVKEIADLKDEIINSYNA 518 LNR + NP + +I +L+ E I S +A Sbjct: 499 LNRRRDENPRNYRSDEGPQITELEPETIESQDA 531 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,912 Number of Sequences: 336 Number of extensions: 2305 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -