BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g13f (645 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 23 8.3 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 23 8.3 AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 23 8.3 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 23 8.3 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 533 VCSGHRGIQEMDLERDPGGIAIFPHGHWLRGT 628 VC R + +++ + + I HG W RGT Sbjct: 221 VCENDRVVIDVENHMEGMELTIHWHGIWQRGT 252 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 533 VCSGHRGIQEMDLERDPGGIAIFPHGHWLRGT 628 VC R + +++ + + I HG W RGT Sbjct: 221 VCENDRVVIDVENHMEGMELTIHWHGIWQRGT 252 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +2 Query: 377 LPSTEQLRSRQCLDAQPPREPQPWEE 454 LP+ + R + + P++P+ WEE Sbjct: 40 LPTVQPGYLRPLIPDEAPQQPEKWEE 65 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +2 Query: 377 LPSTEQLRSRQCLDAQPPREPQPWEE 454 LP+ + R + + P++P+ WEE Sbjct: 71 LPTVQPGYLRPLIPDEAPQQPEKWEE 96 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 561,522 Number of Sequences: 2352 Number of extensions: 9795 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -