BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g13f (645 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75712-7|CAB00046.1| 208|Caenorhabditis elegans Hypothetical pr... 29 2.1 Z35604-1|CAA84676.2| 744|Caenorhabditis elegans Hypothetical pr... 27 8.6 >Z75712-7|CAB00046.1| 208|Caenorhabditis elegans Hypothetical protein K04G2.9 protein. Length = 208 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 572 PSPFLEFLDVLSTQLTIAGVVTVNNFIFEVSYFF 471 P PF L + LT+A V + FIF ++YFF Sbjct: 73 PGPFKGILFGQTILLTVASVAMLLTFIFLIAYFF 106 >Z35604-1|CAA84676.2| 744|Caenorhabditis elegans Hypothetical protein ZK1058.1 protein. Length = 744 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +3 Query: 504 NSYNAGNSQLCAQDIEEFKKWTWNETLEVSQSFLTGTGYEELYDIG 641 +S AG+ L Q I E KK + L V+ + Y+ELYD G Sbjct: 663 SSLAAGHLTLIPQLIGELKKLGRPDILVVAGGVIPPQDYKELYDAG 708 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,316,955 Number of Sequences: 27780 Number of extensions: 218424 Number of successful extensions: 600 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 600 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1423653030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -