BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g12r (485 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 24 0.64 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 5.9 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 24.2 bits (50), Expect = 0.64 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -2 Query: 190 RCRIQHREHRIQKRTGKRVPLSVGDLGTMIKWQPSNVAFINN 65 +CR Q ++H Q+ K L + K P+ V+ NN Sbjct: 123 KCRQQQKQHNQQQSVEKSSKLKNKSAPILTKTSPTPVSINNN 164 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 5.9 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = +1 Query: 124 LITVPSSRCVSEFYVHGVESDTAAEYPHGWRLRYSAFSGSNRGYPGTKRL 273 LI P+ + V + D YP G L + + +NR GT+ L Sbjct: 12 LILTPTDQRVVTRTIPSFLRDDVERYPSGPELSDRSAAYTNRELYGTRAL 61 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,390 Number of Sequences: 336 Number of extensions: 2318 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11315916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -