BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g12f (534 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 24 0.73 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 3.0 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 5.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.8 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 24.2 bits (50), Expect = 0.73 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +2 Query: 296 RCRIQHREHRIQKRTGKRVPLSVGDLGTMIKWQPSNVAFINN 421 +CR Q ++H Q+ K L + K P+ V+ NN Sbjct: 123 KCRQQQKQHNQQQSVEKSSKLKNKSAPILTKTSPTPVSINNN 164 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.2 bits (45), Expect = 3.0 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +3 Query: 405 LLS*ITSSVYQSIKVRNYYCGDTIFNIILCFYLVS 509 +L + Y ++ +YC FN+ L F L S Sbjct: 42 ILDSLVFKCYNLRRIYYFYCVSITFNVHLLFLLCS 76 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.4 bits (43), Expect = 5.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 456 YYCGDTIFNIILC 494 YYC D +N+I C Sbjct: 126 YYCVDGKYNMITC 138 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 6.8 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = -2 Query: 362 LITVPSSRCVSEFYVHGVESDTAAEYPHGWRLRYSAFSGSNRGYPGTKRL 213 LI P+ + V + D YP G L + + +NR GT+ L Sbjct: 12 LILTPTDQRVVTRTIPSFLRDDVERYPSGPELSDRSAAYTNRELYGTRAL 61 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,445 Number of Sequences: 336 Number of extensions: 2618 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -