BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g12f (534 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.64 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 23 2.6 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 23 2.6 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 23 2.6 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 23 2.6 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 2.6 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 2.6 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 2.6 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 2.6 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 2.6 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 3.4 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 3.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.5 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 6.0 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 21 7.9 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 7.9 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 7.9 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 24.6 bits (51), Expect = 0.64 Identities = 19/76 (25%), Positives = 30/76 (39%), Gaps = 1/76 (1%) Frame = +2 Query: 212 GAVWYPDNRDSSQRKRNIAVSNREGIQRRC-RIQHREHRIQKRTGKRVPLSVGDLGTMIK 388 GAVW D + +R+ A S G+ + + H + ++GD Sbjct: 570 GAVWTVDEVEFYKRRPQRACSTTGGVPSKSPTLTHSPTMYGDALNANLQAALGD------ 623 Query: 389 WQPSNVAFINNQQCIS 436 SN+ F+NN C S Sbjct: 624 ---SNMGFLNNSMCTS 636 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 2.6 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = -1 Query: 465 HNNNSEPLYFDIH 427 +NNN +PLY++I+ Sbjct: 94 YNNNYKPLYYNIN 106 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 2.6 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = -1 Query: 465 HNNNSEPLYFDIH 427 +NNN +PLY++I+ Sbjct: 94 YNNNYKPLYYNIN 106 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 2.6 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = -1 Query: 465 HNNNSEPLYFDIH 427 +NNN +PLY++I+ Sbjct: 94 YNNNYKPLYYNIN 106 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 2.6 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = -1 Query: 465 HNNNSEPLYFDIH 427 +NNN +PLY++I+ Sbjct: 94 YNNNYKPLYYNIN 106 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.6 bits (46), Expect = 2.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 282 RVFSGGVGFNTVNIEFRNAP 341 ++ +G + FN VN NAP Sbjct: 382 KIANGDLNFNEVNFRILNAP 401 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.6 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = -1 Query: 465 HNNNSEPLYFDIH 427 +NNN +PLY++I+ Sbjct: 327 YNNNYKPLYYNIN 339 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.6 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = -1 Query: 465 HNNNSEPLYFDIH 427 +NNN +PLY++I+ Sbjct: 327 YNNNYKPLYYNIN 339 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.6 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = -1 Query: 465 HNNNSEPLYFDIH 427 +NNN +PLY++I+ Sbjct: 327 YNNNYKPLYYNIN 339 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 2.6 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = -1 Query: 465 HNNNSEPLYFDIH 427 +NNN +PLY++I+ Sbjct: 316 YNNNYKPLYYNIN 328 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 310 LNPTPPLNTLTVGDCDIPLSLARIAV 233 L P P TVG+CD S+ RI V Sbjct: 228 LRPYPNWEWHTVGNCDGLTSVFRIQV 253 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 3.4 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -1 Query: 465 HNNNSEPLYFDI 430 +NNN +PLY++I Sbjct: 327 YNNNYKPLYYNI 338 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 4.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 424 LVIYESNVRRLPLNHRPQISN 362 L I ESNV+ LP+N + N Sbjct: 152 LEIVESNVQALPVNSLCSLDN 172 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 207 HQEPFGTRITAIRARESGISQ 269 HQ+ +TA+RA+ S SQ Sbjct: 972 HQKKIMNSVTALRAQMSATSQ 992 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = +2 Query: 332 KRTGKRVPLSVGDLGTMIKWQPSNVAFINNQ 424 K+T K P GD+ ++ P+N ++ + Sbjct: 77 KKTDKHPPKDFGDVDSLGNLDPANEFIVSTR 107 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 Query: 92 FDVRLFVGRHYSRNSQHEQNK 30 F+ R RHY R + E N+ Sbjct: 166 FEPRATDSRHYDRYKEEESNE 186 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = +2 Query: 332 KRTGKRVPLSVGDLGTMIKWQPSNVAFINNQ 424 K+T K P GD+ ++ P+N ++ + Sbjct: 93 KKTDKHPPKDFGDVDSLGNLDPANEFIVSTR 123 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,195 Number of Sequences: 438 Number of extensions: 3154 Number of successful extensions: 18 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15090993 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -