BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g12f (534 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50370.1 68416.m05508 expressed protein 29 2.6 At3g49900.1 68416.m05455 BTB/POZ domain-containing protein conta... 28 3.4 At5g04885.1 68418.m00512 glycosyl hydrolase family 3 protein con... 27 5.9 At2g34090.2 68415.m04174 expressed protein similar to GP|130183... 27 5.9 At2g34090.1 68415.m04173 expressed protein similar to GP|130183... 27 5.9 >At3g50370.1 68416.m05508 expressed protein Length = 2179 Score = 28.7 bits (61), Expect = 2.6 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +1 Query: 88 SNLLEDPN*TSASLVSKTVYYFVAMSPVRRQVRPGLISFG--TRSRLVP 228 +N + + N TS S+V K + + SP+ + G I FG T S ++P Sbjct: 1647 ANRISESNSTSTSVVPKNNTFSSSTSPINSLLAEGKIQFGAVTSSTVIP 1695 >At3g49900.1 68416.m05455 BTB/POZ domain-containing protein contains BTB/POZ domain, INTERPRO:IPR000210 Length = 517 Score = 28.3 bits (60), Expect = 3.4 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 1/87 (1%) Frame = +2 Query: 218 VWYPDNRDSSQRKRNIAVSNREGIQRRCRIQHREHRIQKRTGKRVPLSVGD-LGTMIKWQ 394 V P N + +QR +VSN RR R + + QK GKR+ + + + T K Sbjct: 417 VHQPSNVNKTQRGDRGSVSNLSTTYRRRRASPPQAQPQKSIGKRLIMGIKNAFSTSSKQV 476 Query: 395 PSNVAFINNQQCISKYKGSELLLWGHD 475 P A+ + Y G E +W D Sbjct: 477 PKKNAYAVEE----IYDGLEDFVWIKD 499 >At5g04885.1 68418.m00512 glycosyl hydrolase family 3 protein contains Pfam profiles PF00933: Glycosyl hydrolase family 3 N terminal domain, PF01915: Glycosyl hydrolase family 3 C terminal domain Length = 665 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = -2 Query: 353 VPSSRCVSEFYVHGVESDTAAEYPHGWRLRYSAFSGSNRGYPGTKRLLVPK 201 +P R S+ V G +D GW + + FSG N+ GT L K Sbjct: 427 LPLPRKTSKILVAGTHADNLGYQCGGWTITWQGFSG-NKNTRGTTLLSAVK 476 >At2g34090.2 68415.m04174 expressed protein similar to GP|1301832|gnl|PID|e239862|Z71287 Length = 471 Score = 27.5 bits (58), Expect = 5.9 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +3 Query: 201 FWHQEPFGTRITAIRAR--ESGISQSPTVRVFSGGVGFNTVNIEFRNAPGR 347 F ++P T++ A S + P++ VFSGG GFN V E + R Sbjct: 26 FRSKKPHYYNSTSLMAECLSSSTVEPPSLLVFSGGTGFNGVVEELKKLTTR 76 >At2g34090.1 68415.m04173 expressed protein similar to GP|1301832|gnl|PID|e239862|Z71287 Length = 445 Score = 27.5 bits (58), Expect = 5.9 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +3 Query: 201 FWHQEPFGTRITAIRAR--ESGISQSPTVRVFSGGVGFNTVNIEFRNAPGR 347 F ++P T++ A S + P++ VFSGG GFN V E + R Sbjct: 26 FRSKKPHYYNSTSLMAECLSSSTVEPPSLLVFSGGTGFNGVVEELKKLTTR 76 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,430,620 Number of Sequences: 28952 Number of extensions: 233421 Number of successful extensions: 543 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -