BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g09r (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 23 9.9 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 9.9 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 9.9 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 22.6 bits (46), Expect = 9.9 Identities = 14/59 (23%), Positives = 24/59 (40%) Frame = -1 Query: 376 FKSSNVEINENEPVKFSTSRAASRGPVPLISKINDDMPWYQPYVVIGSVAIFMLYFCVL 200 +K ++ + +E + + + P + K D P QPY I S + F VL Sbjct: 67 YKDASASQDSSESLYMANAFRNVSVPATKVLKEEKDQPLIQPYGNIKSCSFFKSLLMVL 125 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 352 NENEPVKFSTSRAA 311 NENEP+ + +RAA Sbjct: 426 NENEPLDYEATRAA 439 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 352 NENEPVKFSTSRAA 311 NENEP+ + +RAA Sbjct: 426 NENEPLDYEATRAA 439 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 523,764 Number of Sequences: 2352 Number of extensions: 8766 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -