BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g09r (598 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC092497-1|AAH92497.1| 132|Homo sapiens LOC283951 protein protein. 30 5.4 AE006467-6|AAK61280.1| 356|Homo sapiens unknown protein. 30 5.4 >BC092497-1|AAH92497.1| 132|Homo sapiens LOC283951 protein protein. Length = 132 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = -1 Query: 358 EINENEPVKFSTSRA-ASRGPVPLISKINDDMPWYQPYVVIGSVAIFMLYFCVLREESDI 182 E + + P++FS+S+A R V PW++ + + + ++ +C LREES+ Sbjct: 43 EDDPDRPIEFSSSKANPHRWSVGHTMGKGHQRPWWK-VLPLSCFLVALIIWCYLREESEA 101 Query: 181 DR 176 D+ Sbjct: 102 DQ 103 >AE006467-6|AAK61280.1| 356|Homo sapiens unknown protein. Length = 356 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = -1 Query: 358 EINENEPVKFSTSRA-ASRGPVPLISKINDDMPWYQPYVVIGSVAIFMLYFCVLREESDI 182 E + + P++FS+S+A R V PW++ + + + ++ +C LREES+ Sbjct: 200 EDDPDRPIEFSSSKANPHRWSVGHTMGKGHQRPWWK-VLPLSCFLVALIIWCYLREESEA 258 Query: 181 DR 176 D+ Sbjct: 259 DQ 260 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,029,806 Number of Sequences: 237096 Number of extensions: 1221334 Number of successful extensions: 5980 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5978 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6324506272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -