BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g09f (581 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13G1.14c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 27 2.6 SPCC613.08 |||CDK regulator |Schizosaccharomyces pombe|chr 3|||M... 26 4.6 SPCC330.05c |ura4||orotidine 5'-phosphate decarboxylase Ura4 |Sc... 25 6.1 SPAC3H1.02c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|... 25 6.1 SPBC1D7.03 |mug80||cyclin Clg1 |Schizosaccharomyces pombe|chr 2|... 25 8.1 SPCC1020.05 |||phosphoprotein phosphatase |Schizosaccharomyces p... 25 8.1 >SPBC13G1.14c |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 243 Score = 26.6 bits (56), Expect = 2.6 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +1 Query: 163 EKMLRNLNYLRHCFRVSGIRFKSSNVEINENEPVKFSTSRAASRGPVPLISKINDDMPWY 342 E + +N + + +R S +N N+ + SRA SR P IS+ +D P Y Sbjct: 180 ESLHKNHKHYENSYRPSR---SQNNSHYNDKSFHRSRYSRARSRSPGSNISEYSDQSPPY 236 Query: 343 QPY 351 Y Sbjct: 237 HSY 239 >SPCC613.08 |||CDK regulator |Schizosaccharomyces pombe|chr 3|||Manual Length = 325 Score = 25.8 bits (54), Expect = 4.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 244 INENEPVKFSTSRAASRGPVPLISKINDD 330 INENEP F+ SR + SK+ DD Sbjct: 212 INENEPYNFTHYLLLSRTYTEIESKLMDD 240 >SPCC330.05c |ura4||orotidine 5'-phosphate decarboxylase Ura4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 264 Score = 25.4 bits (53), Expect = 6.1 Identities = 8/29 (27%), Positives = 18/29 (62%) Frame = +1 Query: 385 YFCVLREESDIDREFDKTLYDRIKGLEKE 471 Y CV++ D+ +FD+ + +++ L K+ Sbjct: 57 YVCVIKTHIDVVEDFDQDMVEKLVALGKK 85 >SPAC3H1.02c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 25.4 bits (53), Expect = 6.1 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 334 PWYQPYVVIGSVAIFMLYFCV-LREESDIDREFDKTLYDRIKGLEKEQL 477 P+ Q +V I +YF V LR I FD ++I GLE+ L Sbjct: 312 PFGQTFVEIEDPFCSFVYFYVSLRVPCSIQLFFDSVPLEKINGLEQRAL 360 >SPBC1D7.03 |mug80||cyclin Clg1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 461 Score = 25.0 bits (52), Expect = 8.1 Identities = 12/55 (21%), Positives = 23/55 (41%) Frame = +1 Query: 223 FKSSNVEINENEPVKFSTSRAASRGPVPLISKINDDMPWYQPYVVIGSVAIFMLY 387 F SSN + + T+ + + P P + + +Y PY +G ++ Y Sbjct: 404 FTSSNATYSGEQKTYSPTTLSTNAPPSPSSGRSCSNCNYYYPYTPVGYYPVYNRY 458 >SPCC1020.05 |||phosphoprotein phosphatase |Schizosaccharomyces pombe|chr 3|||Manual Length = 509 Score = 25.0 bits (52), Expect = 8.1 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 331 MPWYQPYVVIGSVAIFMLYFCVLREESDIDREFDK 435 +PW + Y+ + A+++ VL E+ +DR+ +K Sbjct: 88 IPWKRAYLYVKRPALYIPGETVLVEQVYVDRQLEK 122 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,090,521 Number of Sequences: 5004 Number of extensions: 39164 Number of successful extensions: 104 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 250133048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -