BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g07r (705 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.6 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 21 8.6 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 21 8.6 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 21 8.6 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 8.6 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -1 Query: 225 LHYVDEDIFADVRDVRKLHAELGRSVGMFRVPHATFSHLD 106 L + E +FA RD+R++H G+ +P F+ L+ Sbjct: 273 LDSLPEGLFASTRDLREIHLAYN---GLRDLPKGIFTRLE 309 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 Query: 375 IAVRQIAHYGQLINKNFFRRYDHGRLT 295 I V +I H +L+N F D GR T Sbjct: 32 INVDEILHSDRLLNNYFKCLMDEGRCT 58 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 Query: 375 IAVRQIAHYGQLINKNFFRRYDHGRLT 295 I V +I H +L+N F D GR T Sbjct: 32 INVDEILHSDRLLNNYFKCLMDEGRCT 58 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 Query: 375 IAVRQIAHYGQLINKNFFRRYDHGRLT 295 I V +I H +L+N F D GR T Sbjct: 32 INVDEILHSDRLLNNYFKCLMDEGRCT 58 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 399 KLGHTPAGIAVRQIAHYGQLIN 334 K HTP GI IAH L N Sbjct: 791 KQSHTPNGIVKTWIAHDRYLPN 812 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,348 Number of Sequences: 438 Number of extensions: 4099 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -