BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g07r (705 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g15230.1 68415.m01737 lipase family protein similar to SP|P07... 87 1e-17 At5g14180.1 68418.m01658 lipase family protein similar to SP|Q64... 60 2e-09 At1g72940.1 68414.m08436 disease resistance protein (TIR-NBS cla... 29 3.0 At1g72920.1 68414.m08434 disease resistance protein (TIR-NBS cla... 29 3.0 At3g23280.2 68416.m02935 zinc finger (C3HC4-type RING finger) fa... 28 5.2 At3g23280.1 68416.m02934 zinc finger (C3HC4-type RING finger) fa... 28 5.2 At3g57570.1 68416.m06410 expressed protein 28 6.9 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 28 6.9 At4g04110.1 68417.m00581 Toll-Interleukin-Resistance (TIR) domai... 27 9.2 At3g16090.1 68416.m02033 zinc finger (C3HC4-type RING finger) fa... 27 9.2 >At2g15230.1 68415.m01737 lipase family protein similar to SP|P07098 Triacylglycerol lipase, gastric precursor (EC 3.1.1.3) {Homo sapiens}; contains Pfam profile PF04083: ab-hydrolase associated lipase region Length = 393 Score = 86.6 bits (205), Expect = 1e-17 Identities = 64/219 (29%), Positives = 105/219 (47%), Gaps = 3/219 (1%) Frame = -1 Query: 690 RPEYNSKIIAMQAYAPVAYLEFNANRLL-KLIAPHANSIEALTSLIGINELFGRSDFFTN 514 +P + A P++YL+ L+ +++ H ++ + +G++++ RSD Sbjct: 178 QPHVAEMVEAAALLCPISYLDHVTAPLVERMVFMH---LDQMVVALGLHQINFRSDMLVK 234 Query: 513 LGMRFCADGTFFQAMCTNMLFAFAGRSEDMHNATMLPVKLGHTPAGIAVRQIAHYGQLIN 334 L C +G CT+ L + G + NA+ + L + P +V+ I H Q+I Sbjct: 235 LVDSLC-EG---HMDCTDFLTSITG-TNCCFNASKIEYYLDYEPHPSSVKNIRHLFQMIR 289 Query: 333 KNFFRRYDHGRLTNWRVYRSFTPPRYDLSLITA--PVFLHYVDEDIFADVRDVRKLHAEL 160 K F +YD+G N R Y PP + LS I A P+++ Y D ADV DV AEL Sbjct: 290 KGTFAQYDYGYFKNLRTYGLSKPPEFILSHIPASLPMWMGYGGTDGLADVTDVEHTLAEL 349 Query: 159 GRSVGMFRVPHATFSHLDFMWGSGAKDLLYDRTIQILRS 43 S + + + H+DF+ GS AK+ +Y IQ R+ Sbjct: 350 PSSPELLYL--EDYGHIDFVLGSSAKEDVYKHMIQFFRA 386 >At5g14180.1 68418.m01658 lipase family protein similar to SP|Q64194 Lysosomal acid lipase/cholesteryl ester hydrolase precursor (EC 3.1.1.13) {Rattus norvegicus}; contains Pfam profile PF04083: ab-hydrolase associated lipase region Length = 418 Score = 59.7 bits (138), Expect = 2e-09 Identities = 52/200 (26%), Positives = 91/200 (45%), Gaps = 5/200 (2%) Frame = -1 Query: 648 APVAYLEFNANRLLKLIAPHANSIEALTSLIGINELFGRSDFFTNLGMRFCADGTFFQAM 469 +PVAYL + ++ IA EA TS++G E +S + C Sbjct: 216 SPVAYLS-HMTTVIGDIAAKTFLAEA-TSILGWPEFNPKSGLVGDFIKAICLKAGID--- 270 Query: 468 CTNMLFAFAGRSEDMHNATMLPVKLGHTPAGIAVRQIAHYGQLINKNFFRRYDHGRLT-N 292 C +++ G++ + NA+ + + L + P + + + H Q + R+Y++G N Sbjct: 271 CYDLVSVITGKNCCL-NASTIDLFLANEPQSTSTKNMIHLAQTVRDKELRKYNYGSSDRN 329 Query: 291 WRVYRSFTPPRYDLSLIT--APVFLHYVDEDIFADVRDVRKLHAELG-RSVGMFRVPHAT 121 + Y PP Y++S I P+F Y D ADV+DV L + + V Sbjct: 330 IKHYGQAIPPAYNISAIPHELPLFFSYGGLDSLADVKDVEFLLDQFKYHDIDKMNVQFVK 389 Query: 120 -FSHLDFMWGSGAKDLLYDR 64 ++H DF+ G AKD++Y++ Sbjct: 390 DYAHADFIMGVTAKDVVYNQ 409 >At1g72940.1 68414.m08436 disease resistance protein (TIR-NBS class), putative domain signature TIR-NBS exists, suggestive of a disease resistance protein. Length = 371 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -1 Query: 432 EDMHNATMLPVKLGHTPAGIAVRQIAHYGQLINKNFFRRYDHGRLTNWR 286 E+ + T++P+ G P + RQI + K+ R DH ++ +WR Sbjct: 91 ENKGSITVMPIFYGVDPCHLR-RQIGDVAEQFKKHEAREEDHEKVASWR 138 >At1g72920.1 68414.m08434 disease resistance protein (TIR-NBS class), putative domain signature TIR-NBS exists, suggestive of a disease resistance protein. Length = 275 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -1 Query: 432 EDMHNATMLPVKLGHTPAGIAVRQIAHYGQLINKNFFRRYDHGRLTNWR 286 E+ + T++P+ G P + RQI + K+ R DH ++ +WR Sbjct: 91 ENKGSITVMPIFYGVDPCHLR-RQIGDVAEQFKKHEAREEDHEKVASWR 138 >At3g23280.2 68416.m02935 zinc finger (C3HC4-type RING finger) family protein / ankyrin repeat family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) and Pfam profile: PF00023 ankyrin repeat Length = 438 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = +2 Query: 353 CAICLTAMPAGVCPSFTGNIVALCMSSLRPAKANN 457 CAICL A VC G+ VA CMS L+ K+ N Sbjct: 387 CAICLDAPSEAVCVP-CGH-VAGCMSCLKEIKSKN 419 >At3g23280.1 68416.m02934 zinc finger (C3HC4-type RING finger) family protein / ankyrin repeat family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) and Pfam profile: PF00023 ankyrin repeat Length = 462 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = +2 Query: 353 CAICLTAMPAGVCPSFTGNIVALCMSSLRPAKANN 457 CAICL A VC G+ VA CMS L+ K+ N Sbjct: 411 CAICLDAPSEAVCVP-CGH-VAGCMSCLKEIKSKN 443 >At3g57570.1 68416.m06410 expressed protein Length = 1057 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -1 Query: 642 VAYLEFNANRLLKLIAPHANSIEALTSLIG 553 V L F+++R+LKLI A S++ SLIG Sbjct: 587 VTGLTFDSDRVLKLIPEWARSVQNWNSLIG 616 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 435 CVRQKRITYLCTSPGKMCHQRRISF 509 C + I LCTS GK+ + RR++F Sbjct: 658 CTPGRMIDILCTSSGKITNLRRVTF 682 >At4g04110.1 68417.m00581 Toll-Interleukin-Resistance (TIR) domain-containing protein domain signature TIR exists, suggestive of a disease resistance protein. Length = 239 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -1 Query: 468 CTNMLFAFAGRSEDMHNATMLPVKLGHTPAGIAVRQIAHYGQLINK 331 C N L ED + ++PV G P+ + +QI ++G++ K Sbjct: 113 CLNELLEIVRCKEDSNRLVVIPVFYGLDPSHVR-KQIGNFGKIFKK 157 >At3g16090.1 68416.m02033 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 492 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +3 Query: 429 LHCVRQKRITYLCTSP--GKMCHQRRISF 509 LH + QKR+ Y+ T+P K+ H R +SF Sbjct: 116 LHWLAQKRVEYIETTPSVSKLSHFRIVSF 144 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,000,161 Number of Sequences: 28952 Number of extensions: 319325 Number of successful extensions: 690 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 688 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -