BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g04f (603 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 36 3e-04 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 26 0.25 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 25 0.57 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 25 0.76 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 25 0.76 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 25 0.76 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 25 0.76 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 25 0.76 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 25 0.76 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 25 0.76 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 25 0.76 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 25 0.76 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 25 0.76 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 24 1.00 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 24 1.00 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 24 1.00 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 3.0 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 4.0 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 5.3 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 5.3 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 22 5.3 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 7.0 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 9.3 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 35.9 bits (79), Expect = 3e-04 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +2 Query: 185 TRIVGGSAANAGAHPHLAGLVIALTNGRTSICGASLLTNTRSVTAAHC 328 +RIVGG+ P +AG+ G ICGA++++ +TAAHC Sbjct: 159 SRIVGGTNTGINEFPMMAGIKRTYEPGM--ICGATIISKRYVLTAAHC 204 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 26.2 bits (55), Expect = 0.25 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +2 Query: 407 VTTSSVHMHGSYNMNNLHNDVAVINHNHVGFNN 505 ++ ++H + +YN NN +N+ N+N+ +NN Sbjct: 318 LSNKTIHNNNNYNNNNYNNNYN--NYNNNNYNN 348 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 25.0 bits (52), Expect = 0.57 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +2 Query: 407 VTTSSVHMHGSYNMNNLHNDVAVINHNHVGFNN 505 ++ ++H + +YN NN +N N+N+ +NN Sbjct: 85 LSNKTIHNNNNYNNNNYNN----YNYNNNNYNN 113 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.76 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 404 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 520 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.76 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 404 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 520 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.76 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 404 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 520 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.76 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 404 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 520 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.76 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 404 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 520 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.76 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 404 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 520 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.76 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 404 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 520 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.76 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 404 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 520 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.6 bits (51), Expect = 0.76 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 404 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 520 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 313 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 352 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.6 bits (51), Expect = 0.76 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 404 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 520 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 313 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 352 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.00 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 404 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 520 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNPLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 1.00 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 437 SYNMNNLHNDVAVINHNHVGFNNN 508 S + N +HN+ N+N+ +NNN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 1.00 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 437 SYNMNNLHNDVAVINHNHVGFNNN 508 S + N +HN+ N+N+ +NNN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/21 (33%), Positives = 10/21 (47%) Frame = +1 Query: 199 WFCRQRWCSPPSCWTCDRTHE 261 W CR ++ S W D H+ Sbjct: 926 WSCRCKFLQELSSWVSDNAHK 946 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 117 TPRSVSPGPRVLSAPRKPLTS 179 T S SP PR+ SAP +S Sbjct: 507 TNSSPSPNPRIASAPSSSTSS 527 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 397 SGEDVSCAKSEGELTSLGIPG 335 +G D+S + GE LG+PG Sbjct: 184 AGGDISSFITNGEWDLLGVPG 204 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 5.3 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = +1 Query: 235 CWTCDRTHEWQ 267 CW CD+ E++ Sbjct: 467 CWVCDQCEEYE 477 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 5.3 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = +1 Query: 235 CWTCDRTHEWQ 267 CW CD+ E++ Sbjct: 557 CWVCDQCEEYE 567 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.8 bits (44), Expect = 5.3 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 546 LLVLGPGLPASAELPMLLR 602 LL GP PA AE+P L+ Sbjct: 97 LLEAGPDEPAGAEIPSNLQ 115 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.0 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = +2 Query: 407 VTTSSVHMHGSYNMNNLHN 463 ++ ++H + +YN NN +N Sbjct: 85 LSNKTIHNNNNYNNNNYNN 103 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.0 bits (42), Expect = 9.3 Identities = 5/8 (62%), Positives = 5/8 (62%) Frame = +1 Query: 196 GWFCRQRW 219 GW C RW Sbjct: 377 GWICEHRW 384 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,042 Number of Sequences: 438 Number of extensions: 2869 Number of successful extensions: 28 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -