BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g01r (452 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1022 - 8815675-8816809,8819696-8819907 32 0.25 01_06_1623 - 38716606-38717424 29 1.7 02_05_0162 + 26398252-26399886 27 7.1 01_01_0103 - 773727-774737,774797-774813,774852-775078,777465-77... 27 7.1 02_05_0612 + 30348495-30348995,30349679-30350023 27 9.3 >07_01_1022 - 8815675-8816809,8819696-8819907 Length = 448 Score = 31.9 bits (69), Expect = 0.25 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 367 NQFVGTWXWAAGYGRTXDASGSNTRK 290 N G+W WA G+GR +A+G N ++ Sbjct: 79 NYSEGSWVWAPGHGRRYNATGCNVKE 104 >01_06_1623 - 38716606-38717424 Length = 272 Score = 29.1 bits (62), Expect = 1.7 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = -2 Query: 427 RVGYXNVIQPIFLXPSHLXNNQFVGTWXWAAGYGRTXDASGS 302 R+ Y N P ++ H+ Q +G W W + DA+G+ Sbjct: 221 RIRYANDRIPPYIVSRHVVPVQILGIWVWDESQSQYVDANGA 262 >02_05_0162 + 26398252-26399886 Length = 544 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = -3 Query: 204 TPRGXAAPXXE-TPVDPSXSRMEERRTLIGITSXGAAQCQRGHPAGFARV 58 TP+ AAP E +P++PS + + + A + R H A RV Sbjct: 28 TPQQRAAPRREQSPLNPSSQSIRSASSGTELAGSAATEASRAHIANLDRV 77 >01_01_0103 - 773727-774737,774797-774813,774852-775078,777465-778237 Length = 675 Score = 27.1 bits (57), Expect = 7.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 13 CNHLESSTYPRSERGDP 63 C HL++ +YP RGDP Sbjct: 39 CGHLQNVSYPFRRRGDP 55 >02_05_0612 + 30348495-30348995,30349679-30350023 Length = 281 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 117 ITSXGAAQCQRGHPAGFARVTSFASWIRARL 25 +T+ G A G G RV ++ W+RAR+ Sbjct: 97 VTNRGVATAVSGTGYGDYRVRDYSEWLRARI 127 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,916,199 Number of Sequences: 37544 Number of extensions: 224411 Number of successful extensions: 508 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 507 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 883560296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -