BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12g01r (452 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U93847-1|AAB58269.1| 760|Caenorhabditis elegans elongation fact... 29 2.1 U93846-1|AAB58268.1| 768|Caenorhabditis elegans elongation fact... 29 2.1 U10414-7|AAN63383.1| 768|Caenorhabditis elegans Elongation fact... 29 2.1 U10414-6|AAN63384.1| 760|Caenorhabditis elegans Elongation fact... 29 2.1 Z50795-1|CAA90662.1| 502|Caenorhabditis elegans Hypothetical pr... 28 3.7 U22832-2|AAA64509.2| 571|Caenorhabditis elegans Hypothetical pr... 27 4.8 Z66524-7|CAA91419.2| 626|Caenorhabditis elegans Hypothetical pr... 27 8.4 >U93847-1|AAB58269.1| 760|Caenorhabditis elegans elongation factor-2 kinase EFK-1B isoform protein. Length = 760 Score = 28.7 bits (61), Expect = 2.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 25 ESSTYPRSERGDPGEXSRMSPLTLSSAXRGD 117 E YPRSE+ + SR S +++S+ GD Sbjct: 408 EEEDYPRSEKSGNSQKSRRSRMSISTRSSGD 438 >U93846-1|AAB58268.1| 768|Caenorhabditis elegans elongation factor-2 kinase EFK-1A isoform protein. Length = 768 Score = 28.7 bits (61), Expect = 2.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 25 ESSTYPRSERGDPGEXSRMSPLTLSSAXRGD 117 E YPRSE+ + SR S +++S+ GD Sbjct: 408 EEEDYPRSEKSGNSQKSRRSRMSISTRSSGD 438 >U10414-7|AAN63383.1| 768|Caenorhabditis elegans Elongation factor kinase protein1, isoform a protein. Length = 768 Score = 28.7 bits (61), Expect = 2.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 25 ESSTYPRSERGDPGEXSRMSPLTLSSAXRGD 117 E YPRSE+ + SR S +++S+ GD Sbjct: 408 EEEDYPRSEKSGNSQKSRRSRMSISTRSSGD 438 >U10414-6|AAN63384.1| 760|Caenorhabditis elegans Elongation factor kinase protein1, isoform b protein. Length = 760 Score = 28.7 bits (61), Expect = 2.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 25 ESSTYPRSERGDPGEXSRMSPLTLSSAXRGD 117 E YPRSE+ + SR S +++S+ GD Sbjct: 408 EEEDYPRSEKSGNSQKSRRSRMSISTRSSGD 438 >Z50795-1|CAA90662.1| 502|Caenorhabditis elegans Hypothetical protein R166.1 protein. Length = 502 Score = 27.9 bits (59), Expect = 3.7 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -1 Query: 446 GYDYPRTGRIXKCDPADLPXPLTS 375 GY+Y ++ R CDPADL P++S Sbjct: 430 GYNYAKS-RKRPCDPADLHSPISS 452 >U22832-2|AAA64509.2| 571|Caenorhabditis elegans Hypothetical protein C09F5.1 protein. Length = 571 Score = 27.5 bits (58), Expect = 4.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 122 SGSPRLALLNVSGDIRLXSPGSPRS 48 SG+ + LN SGD R+ PG+ RS Sbjct: 93 SGATNSSFLNTSGDSRVSYPGADRS 117 >Z66524-7|CAA91419.2| 626|Caenorhabditis elegans Hypothetical protein T13H5.3 protein. Length = 626 Score = 26.6 bits (56), Expect = 8.4 Identities = 12/19 (63%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -1 Query: 452 RRGYDYPR--TGRIXKCDP 402 R GY+ PR TG+I KCDP Sbjct: 572 RCGYNAPRLSTGKIPKCDP 590 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,448,322 Number of Sequences: 27780 Number of extensions: 170178 Number of successful extensions: 356 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 356 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 799252350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -