BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12f23f (607 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 26 0.33 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 4.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 4.1 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 22 4.1 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 7.1 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 25.8 bits (54), Expect = 0.33 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 389 MPNQVLTIEPQNELKFKVNFSGLFEHGCTTYMRLTNPTNDT 511 +P+Q+L I+ + LK +GL G Y R+ PT T Sbjct: 1243 LPSQLLNIKTLHGLKVIPTPAGLKTTGAAVYARVIAPTTIT 1283 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/34 (26%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Frame = +1 Query: 265 CSAHV-----YSSFHNSRSLWPTSRKDIFSQSVK 351 C+ HV + FHN LW + +K + ++ Sbjct: 787 CAGHVRLPYTFEQFHNKELLWTSVKKALMIVGIR 820 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/34 (26%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Frame = +1 Query: 265 CSAHV-----YSSFHNSRSLWPTSRKDIFSQSVK 351 C+ HV + FHN LW + +K + ++ Sbjct: 825 CAGHVRLPYTFEQFHNKELLWTSVKKALMIVGIR 858 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 187 FLISIHKIQIALRIYAF 237 FL+ I +QIA+ +YAF Sbjct: 87 FLLFILLVQIAVAVYAF 103 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -2 Query: 390 ILLYYKHSISLAKF 349 ILLYY+ S++L+ F Sbjct: 315 ILLYYRDSLALSVF 328 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,819 Number of Sequences: 438 Number of extensions: 3798 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17848938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -