BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12f19r (712 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10961| Best HMM Match : Porin_3 (HMM E-Value=0) 155 3e-38 SB_4373| Best HMM Match : Porin_3 (HMM E-Value=0.0041) 93 3e-19 SB_26394| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.88) 32 0.53 SB_59592| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_14840| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_21309| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_8824| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_24031| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_41021| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_59014| Best HMM Match : CCT (HMM E-Value=6.4) 28 8.6 SB_44111| Best HMM Match : OAD_gamma (HMM E-Value=4.4) 28 8.6 >SB_10961| Best HMM Match : Porin_3 (HMM E-Value=0) Length = 379 Score = 155 bits (377), Expect = 3e-38 Identities = 67/147 (45%), Positives = 99/147 (67%) Frame = -1 Query: 712 PVVDVAAVLNYQGWLAGVHTQFDTQKAKFSKNNFALGYQSGDFALHTNVDNGKDFGGSIY 533 P V +AV+ Y+GW AG +DT K+K NNF+LGY++ DF +H+ V++ F GSIY Sbjct: 232 PTVQGSAVVGYEGWHAGYQVAYDTSKSKLIANNFSLGYRAKDFQIHSAVNDASKFTGSIY 291 Query: 532 QKVSDKLDCGVSMKWTAGSADTLFGVGAKYALDQDASLHAKINNKSLIGLGYQQKLRPGV 353 ++S L+ + W GS++T F G KY +D+D +L AK+NN S +GL Y Q+LR G+ Sbjct: 292 HQISKNLEVAAQLNWATGSSNTSFQGGCKYDVDKDTTLRAKVNNNSHLGLAYTQRLRDGI 351 Query: 352 TLTLSAAIDGQNFNAGGHKVGVALELE 272 T+S+ ID +N N GGHK+G++LE+E Sbjct: 352 KATVSSHIDTKNLNQGGHKLGLSLEME 378 >SB_4373| Best HMM Match : Porin_3 (HMM E-Value=0.0041) Length = 187 Score = 92.7 bits (220), Expect = 3e-19 Identities = 39/86 (45%), Positives = 59/86 (68%) Frame = -1 Query: 529 KVSDKLDCGVSMKWTAGSADTLFGVGAKYALDQDASLHAKINNKSLIGLGYQQKLRPGVT 350 ++S L+ + W GS++T F G KY +D+D +L AK+NN S +GL Y Q+LR G+ Sbjct: 101 EISKNLEVAAQLNWATGSSNTSFQGGCKYDVDKDTTLRAKVNNNSHLGLAYTQRLRDGIK 160 Query: 349 LTLSAAIDGQNFNAGGHKVGVALELE 272 T+S+ ID +N N GGHK+G++LE+E Sbjct: 161 ATVSSHIDTKNLNQGGHKLGLSLEME 186 >SB_26394| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.88) Length = 842 Score = 31.9 bits (69), Expect = 0.53 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +3 Query: 321 CPSMAADNVRVTPGRSFCW*PRPMRDLLLILACRDASWSSAYFAPTPNNV--SAEPAVHF 494 CP A VRV+P RS W R + L+ AC + S +P P ++ S P + Sbjct: 202 CPHHAVSGVRVSPPRSI-WCSRVLTTQYLVFACPHHAVSGVRVSP-PRSIWCSRVPTTQY 259 Query: 495 MLTP 506 + +P Sbjct: 260 LYSP 263 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +3 Query: 321 CPSMAADNVRVTPGRSFCW*PRPMRDLLLILACRDASWSSAYFAP 455 CP A +VRV+P RS W R + L+ AC + S +P Sbjct: 171 CPHHAVSSVRVSPPRSI-WCSRVLTTQYLVFACPHHAVSGVRVSP 214 >SB_59592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 31.1 bits (67), Expect = 0.92 Identities = 27/79 (34%), Positives = 37/79 (46%), Gaps = 2/79 (2%) Frame = -2 Query: 432 KTRLCTPRSTTSPSSVLVTNRNYAQA*PLHCLLPSMDRTSMQVATRLALPSNSSPRKYNQ 253 + R+CT R T +P+ +YA+ C+LP T QV R PS+ Y Q Sbjct: 21 RQRVCTTRPTHTPTGAYYQTNSYAK----RCVLPD-HLTRQQV--RTTRPSHMPTGAYYQ 73 Query: 252 T--YSCR*IHTVVTTKQRV 202 T Y+ R + T T QRV Sbjct: 74 TILYANRCVLTEHLTCQRV 92 >SB_14840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = -3 Query: 437 GPRRVSARQDQQQVPH---RSWLPTETTPRRNPYI 342 G R Q Q Q+PH +S +PT T P NP++ Sbjct: 88 GRARYHGGQSQSQIPHGQRKSQIPTWTAPEPNPHV 122 >SB_21309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1286 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 299 QGWRCPRTRALENITKPTLVDKYILLSQPNSV 204 QGW + + NI PT+VD Y +L + +S+ Sbjct: 154 QGWSADNIK-MRNIDDPTVVDDYSILGEADSI 184 >SB_8824| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = -3 Query: 428 RVSARQDQQQVPH---RSWLPTETTPRRNPYI 342 R Q Q Q+PH +S +PT T P NP++ Sbjct: 4 RYHGGQSQSQIPHGQRKSQIPTWTAPEPNPHV 35 >SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 28.7 bits (61), Expect = 4.9 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = -1 Query: 589 DFALHTNVDNGKDFGGSIYQKV 524 ++ +H ++ G+D+GGS YQ+V Sbjct: 394 EYGIHLSLTVGRDYGGSYYQQV 415 >SB_24031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1176 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/75 (25%), Positives = 30/75 (40%) Frame = -3 Query: 419 ARQDQQQVPHRSWLPTETTPRRNPYIVCCHRWTELQCRWPQGWRCPRTRALENITKPTLV 240 ARQ++ + +R WL R I R+ Q + P + IT P ++ Sbjct: 855 ARQEEVKEAYRKWLDDFMKSAREKEIAENSRYASTQAATSAPYASPPPSPYQQITSPQVM 914 Query: 239 DKYILLSQPNSVYRE 195 LS P+S Y + Sbjct: 915 QS--TLSPPDSQYNQ 927 >SB_41021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/45 (24%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -3 Query: 332 HRWTELQCRWPQGWRCPRTRALENITKPTLVDK-YILLSQPNSVY 201 H++ +++ W+C R ++L + P +K Y QPN+++ Sbjct: 170 HKYKDIEFETRNKWQCLRHQSLSLLKVPNYSNKHYCAFCQPNNIF 214 >SB_59014| Best HMM Match : CCT (HMM E-Value=6.4) Length = 249 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 529 SGRLNRRNLYHCLRLCGEQSHQIGNLEQSCSWRTLLFVYQTGCVHQ 666 S R+NRR + H +R C + + G + C+W + T VH+ Sbjct: 157 STRMNRR-IRHLVRRCCKLGAKGGEMGFDCNWDRFTALQYTNIVHR 201 >SB_44111| Best HMM Match : OAD_gamma (HMM E-Value=4.4) Length = 305 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = -3 Query: 455 WSEVRAG--PRRVSARQDQQQVPHRSWLPTETTPRRNPYIVCCHRWTELQCRWPQGWRCP 282 W E RA PR D+ ++ T+ T RR + V C+ + L +GWR P Sbjct: 85 WRESRAPNHPRPDLNTLDESKLEGAWQSGTDLTERRKRHFVSCNTLSRLSLASRRGWRGP 144 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,732,454 Number of Sequences: 59808 Number of extensions: 543367 Number of successful extensions: 1450 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1444 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -