BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12f17r (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20370.1 68418.m02423 serine-rich protein-related contains so... 30 1.6 At4g28080.1 68417.m04027 expressed protein 29 2.9 At1g02120.1 68414.m00138 GRAM domain-containing protein-related ... 29 3.8 At2g32800.1 68415.m04015 protein kinase family protein contains ... 28 6.6 At3g51040.2 68416.m05589 expressed protein contains Pfam PF05608... 27 8.8 At3g51040.1 68416.m05588 expressed protein contains Pfam PF05608... 27 8.8 >At5g20370.1 68418.m02423 serine-rich protein-related contains some similarity to serine-rich proteins Length = 175 Score = 29.9 bits (64), Expect = 1.6 Identities = 20/61 (32%), Positives = 32/61 (52%) Frame = -2 Query: 532 SFQKRISGASEKDIVHSGLDYTMERSARAIMKTAMRFNLGLDLRTAAYANSIEKIFTTYA 353 SF +R+ K + S T++R+ R +R N+GL+LR A NS+ KI + A Sbjct: 85 SFHRRLEHEKSKTLASS----TVKRNNRG--DNTIRVNVGLNLRKLALMNSLAKIGSVEA 138 Query: 352 D 350 + Sbjct: 139 E 139 >At4g28080.1 68417.m04027 expressed protein Length = 1660 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +1 Query: 205 VVISLYCKMKEINIGLNLRST---LEFLRKYYTDNTL 306 V + Y ++KE G +L+S +E RKYYTD L Sbjct: 502 VTETAYQRLKESETGFHLKSPKELIEMARKYYTDTAL 538 >At1g02120.1 68414.m00138 GRAM domain-containing protein-related contains low similarity to PF02893: GRAM domain Length = 556 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -1 Query: 533 VLPEENLRRLREGHRALRTRLHHGE 459 ++ E+ L+R+R+ H AL+ + HH E Sbjct: 524 MMVEDRLQRMRQDHAALKAQFHHLE 548 >At2g32800.1 68415.m04015 protein kinase family protein contains dual protein kinase domains, Pfam:PF00069 Length = 851 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = -2 Query: 631 ERESNYHLLESVQESLERRFG--RVGGRIPVTPSESFQKRISGASEKDIVHSGL 476 E +S+Y + S + R R+GG I P ESF+K+ ++ D+ G+ Sbjct: 281 EHDSSYDSVSSFRNHQFRVADSTRIGGTIGYLPPESFRKKTVATAKTDVFSFGV 334 >At3g51040.2 68416.m05589 expressed protein contains Pfam PF05608: Protein of unknown function (DUF778) Length = 231 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = -1 Query: 500 EGHRALRTRLHHGEIR*GHHEDSHEVQPRFRSEDSRVCELHRKDIHHVCRCRSSFLIIHL 321 E R+ + + +GE R EDSHE +P + + + ++ +++ C + + Sbjct: 90 ESSRSSSSGMFNGERRYEQEEDSHEKEPTWDDALRKSTQEYQHHSYNILTCNCHSFVANN 149 Query: 320 LN 315 LN Sbjct: 150 LN 151 >At3g51040.1 68416.m05588 expressed protein contains Pfam PF05608: Protein of unknown function (DUF778) Length = 231 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = -1 Query: 500 EGHRALRTRLHHGEIR*GHHEDSHEVQPRFRSEDSRVCELHRKDIHHVCRCRSSFLIIHL 321 E R+ + + +GE R EDSHE +P + + + ++ +++ C + + Sbjct: 90 ESSRSSSSGMFNGERRYEQEEDSHEKEPTWDDALRKSTQEYQHHSYNILTCNCHSFVANN 149 Query: 320 LN 315 LN Sbjct: 150 LN 151 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,394,496 Number of Sequences: 28952 Number of extensions: 301863 Number of successful extensions: 619 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -