BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12f17f (573 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0509 + 3694689-3695683,3695799-3695946,3696864-3696943,369... 28 6.1 07_03_1079 - 23798005-23798760 27 8.0 >02_01_0509 + 3694689-3695683,3695799-3695946,3696864-3696943, 3697214-3698062,3698193-3698337,3698426-3698677, 3698780-3699089,3699415-3699524 Length = 962 Score = 27.9 bits (59), Expect = 6.1 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = +2 Query: 338 HMVEYFFHRACQVVEDKLVEDLKSRTPIEEKKKKVAGILKLMEPCDHILEIQFPLRRDS 514 H F AC ++ KLV+ L +EE+ +L L+ LE +PL++D+ Sbjct: 882 HGCNTFQPLACSILATKLVDSLSYDRVLEERVLASLSLLNLVRH-PECLEKLYPLKKDT 939 >07_03_1079 - 23798005-23798760 Length = 251 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -2 Query: 452 EYRLLSFSSLQWVSLTSNLQQACLRQLDRLGGKNILPCGRT 330 E RLL+ +SL+ + + QA ++R G +N+ CG + Sbjct: 112 ELRLLARNSLRGSARLAGALQALRATIERFGSENVCLCGHS 152 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,839,474 Number of Sequences: 37544 Number of extensions: 317388 Number of successful extensions: 724 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1328870592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -