BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12f15f (602 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearl... 32 0.34 At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearl... 32 0.34 At1g30450.3 68414.m03722 cation-chloride cotransporter, putative... 30 1.0 At1g30450.2 68414.m03721 cation-chloride cotransporter, putative... 30 1.0 At1g30450.1 68414.m03720 cation-chloride cotransporter, putative... 30 1.0 At4g16080.1 68417.m02438 hypothetical protein contains Pfam prof... 29 3.1 At2g01050.1 68415.m00010 hypothetical protein 28 4.1 At4g11530.1 68417.m01850 protein kinase family protein contains ... 28 5.5 At1g49740.1 68414.m05578 expressed protein similar to MAP3K-like... 28 5.5 At4g33600.1 68417.m04773 expressed protein 27 7.2 At4g26965.1 68417.m03880 NADH:ubiquinone oxidoreductase family p... 27 9.6 At4g11510.1 68417.m01849 expressed protein ; expression support... 27 9.6 >At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearly identical to 3-phosphoserine phosphatase GI:3759177 from [Arabidopsis thaliana] Length = 295 Score = 31.9 bits (69), Expect = 0.34 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = -2 Query: 466 NTLGYYDTLLDNSTLLDVWAEVDGMCYSYDAHILV 362 +TLG+ ++ + +LD+W V+ +C+ D+ + V Sbjct: 62 STLGHEGNIVPSKEILDLWRSVEAVCFDVDSTVCV 96 >At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearly identical to 3-phosphoserine phosphatase GI:3759177 from [Arabidopsis thaliana] Length = 295 Score = 31.9 bits (69), Expect = 0.34 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = -2 Query: 466 NTLGYYDTLLDNSTLLDVWAEVDGMCYSYDAHILV 362 +TLG+ ++ + +LD+W V+ +C+ D+ + V Sbjct: 62 STLGHEGNIVPSKEILDLWRSVEAVCFDVDSTVCV 96 >At1g30450.3 68414.m03722 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 221 LKGSGSW*EQYQRTVGTIDSRWV 153 +KG W +YQR GTID W+ Sbjct: 767 IKGLDEWPNEYQRQYGTIDLYWI 789 >At1g30450.2 68414.m03721 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 221 LKGSGSW*EQYQRTVGTIDSRWV 153 +KG W +YQR GTID W+ Sbjct: 767 IKGLDEWPNEYQRQYGTIDLYWI 789 >At1g30450.1 68414.m03720 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 221 LKGSGSW*EQYQRTVGTIDSRWV 153 +KG W +YQR GTID W+ Sbjct: 767 IKGLDEWPNEYQRQYGTIDLYWI 789 >At4g16080.1 68417.m02438 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 379 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -3 Query: 585 PLYCSLQFSLLVTMSSSLWRLPSDTL 508 P Y L FS+LVT +SLW L D + Sbjct: 212 PQYHELNFSILVTGHTSLWSLLQDNV 237 >At2g01050.1 68415.m00010 hypothetical protein Length = 515 Score = 28.3 bits (60), Expect = 4.1 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 5/90 (5%) Frame = -2 Query: 592 IMTLVLFPAVFFVGHNEFELVEVAVRYTAALNGSSPSEQINKNTL-----GYYDTLLDNS 428 +MT++ P FF+ FEL E Y AAL G P + L +D L D+ Sbjct: 108 VMTVMDLPRQFFM--IRFELEE---EYMAALTGG-PWRVLGNYLLVQDWSSRFDPLRDDI 161 Query: 427 TLLDVWAEVDGMCYSYDAHILVVILLREFG 338 VW + + Y+Y L++ + R G Sbjct: 162 VTTPVWVRLSNIPYNYYHRCLLMEIARGLG 191 >At4g11530.1 68417.m01850 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 931 Score = 27.9 bits (59), Expect = 5.5 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = +2 Query: 158 ILNQWFQQCAGIVLTNYHYLSTATCFHGEF-----YDPAYRRIIA 277 +LN F L + Y+ST TCF+G F YD RRI++ Sbjct: 2 MLNTLFLPIFLFFLITFDYVSTQTCFNGYFKPNGTYDLNRRRILS 46 >At1g49740.1 68414.m05578 expressed protein similar to MAP3K-like protein kinase GB:CAB16796 GI:4006878 from [Arabidopsis thaliana] Length = 359 Score = 27.9 bits (59), Expect = 5.5 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 7/77 (9%) Frame = -2 Query: 550 HNEF-ELVEVAVRYTAAL----NGSSPSEQINKNTLGYYDTLLDNSTLLDVWA--EVDGM 392 HN F L EV+ +A L S + Q+N G+ + D D+W DG Sbjct: 84 HNSFARLGEVSRTGSAILAPTNQQDSITSQLNNGVRGFMLDMYDFQN--DIWLCHSFDGT 141 Query: 391 CYSYDAHILVVILLREF 341 C+++ A + +LREF Sbjct: 142 CFNFTAFQPAINILREF 158 >At4g33600.1 68417.m04773 expressed protein Length = 453 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 160 LESMVPTVRWYCSHQLPLPFNCYLFPWRILR 252 L +MVP V W HQ P L+ W LR Sbjct: 183 LSAMVPFVAWSLRHQCENPQRWVLYHWGELR 213 >At4g26965.1 68417.m03880 NADH:ubiquinone oxidoreductase family protein contains Pfam profile PF05071: NADH:ubiquinone oxidoreductase 17.2 kD subunit Length = 184 Score = 27.1 bits (57), Expect = 9.6 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 599 RRDHDPCTVPCSFLCW 552 RR+ DP ++P ++CW Sbjct: 47 RREEDPTSIPVEWICW 62 >At4g11510.1 68417.m01849 expressed protein ; expression supported by MPSS Length = 85 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +1 Query: 352 GELRQGCEHRTSNTCHPLRPKHPAGCYYPTRCR 450 G+ + GC+H P P H GC RCR Sbjct: 42 GDRQPGCDHGNCPPDQPANPYH-RGCEKSKRCR 73 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,991,380 Number of Sequences: 28952 Number of extensions: 310846 Number of successful extensions: 819 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 819 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -