BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12f14r (647 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 64 1e-12 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 24 1.5 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 24 1.5 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 23 3.4 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 23 3.4 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 4.4 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 64.1 bits (149), Expect = 1e-12 Identities = 48/195 (24%), Positives = 88/195 (45%), Gaps = 9/195 (4%) Frame = -2 Query: 610 VCGASLVTTNRLLTAAHCWFD-GTNQXXXXXXXXXXXXLFSGGTRV--ETSSIVMHPNWS 440 +CGA++++ +LTAAHC D T + V + +++HP + Sbjct: 187 ICGATIISKRYVLTAAHCIIDENTTKLAIVVGEHDWSSKTETNATVLHSINKVIIHPKYD 246 Query: 439 PATIR----NDVAVIYLPSPVTLSDTINTIALPSGQELQENFVGSSAVASGFGLTSSSGS 272 ND+A++ + D + LP Q ++F GS G+G TS +G Sbjct: 247 IIEKDDWQINDIALLKTEKDIKFGDKVGPACLPF-QHFLDSFAGSDVTVLGWGHTSFNGM 305 Query: 271 ITTNQVLSHVNLDVINNFVCTFAFPFVLQSSNLCTSGRGGVGTCRGDSGGPLV--VTRNN 98 ++ +L L+++ C + ++ ++ +C +G C+ DSGGP++ R Sbjct: 306 LS--HILQKTTLNMLTQVECYKYYGNIMVNA-MCAYAKGK-DACQMDSGGPVLWQNPRTK 361 Query: 97 RPILIGITSFGSGLG 53 R + IGI S+G+ G Sbjct: 362 RLVNIGIISWGAECG 376 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 147 PTPPRPLVHKFEDCKTKGKANVQ 215 P PP PL + ED G+A ++ Sbjct: 440 PLPPLPLHTECEDLSVSGEAGIE 462 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 147 PTPPRPLVHKFEDCKTKGKANVQ 215 P PP PL + ED G+A ++ Sbjct: 440 PLPPLPLHTECEDLSVSGEAGIE 462 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 78 IPIKIGRLFLVTTRGPPESPRQVPTPPRPLVHKFEDC 188 IP IG L P Q+P PR + EDC Sbjct: 69 IPAWIGELSATKFGFPCLQYTQLPVNPRDKIEGAEDC 105 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 78 IPIKIGRLFLVTTRGPPESPRQVPTPPRPLVHKFEDC 188 IP IG L P Q+P PR + EDC Sbjct: 69 IPAWIGELSATKFGFPCLQYTQLPVNPRDKIEGAEDC 105 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/23 (30%), Positives = 16/23 (69%) Frame = -2 Query: 130 SGGPLVVTRNNRPILIGITSFGS 62 +G P+V+ N+ + +G+++ GS Sbjct: 1201 AGKPIVLASGNKNVGVGVSNSGS 1223 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,679 Number of Sequences: 438 Number of extensions: 4828 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -