BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12f06r (735 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 26 0.32 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 5.2 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 26.2 bits (55), Expect = 0.32 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -3 Query: 676 IRFGRXTSCIPTGASLWGCRYRVADHVPSSGGSCW 572 I F + C+P + CR R + ++ SG W Sbjct: 35 IHFLQYPGCVPKPIPSYACRGRCSSYLQVSGSKIW 69 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 315 EKLSLGINLFLTATI 271 EKLSLG+ + L+ T+ Sbjct: 261 EKLSLGVTILLSLTV 275 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,513 Number of Sequences: 438 Number of extensions: 4580 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -