BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12f06f (567 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1165 - 9267891-9268145,9268395-9268510,9268991-9269127,926... 72 3e-13 03_02_0544 - 9362615-9362674,9362783-9362857,9362934-9363144,936... 49 3e-06 05_04_0333 + 20333243-20333329,20335048-20335110,20335276-203353... 47 1e-05 05_03_0407 + 13582595-13582681,13583067-13583129,13583289-135833... 47 1e-05 07_01_1091 - 10015180-10015236,10015705-10015779,10015874-100161... 45 5e-05 09_06_0256 + 21887666-21888670 31 0.64 09_04_0425 - 17448906-17449195,17449489-17449600 31 0.64 01_03_0044 - 11927272-11928516 31 0.85 03_02_0127 + 5777564-5779879 29 2.6 10_08_0894 - 21365629-21365766,21365849-21365950,21366042-213662... 28 4.5 10_08_0505 + 18384392-18384454,18384593-18384679,18385878-183864... 28 4.5 06_03_1252 + 28753584-28753883,28754693-28754886,28755192-28755597 28 4.5 10_01_0053 - 767131-767962,768517-769037,769384-769601,769720-76... 28 6.0 05_03_0265 - 11293020-11293329,11293911-11294232,11294332-11294455 28 6.0 03_05_0980 - 29384046-29384117,29384901-29384998,29385656-293857... 28 6.0 01_06_0893 - 32766994-32768841,32769596-32769782,32769860-327699... 28 6.0 11_05_0095 + 19009866-19010159,19010255-19010448,19012183-19012582 27 7.9 06_01_1115 - 9186521-9187000 27 7.9 04_04_0476 - 25508952-25509004,25509245-25509326,25509453-255096... 27 7.9 03_02_0232 + 6614784-6614882,6616145-6616477,6616708-6616967,661... 27 7.9 >01_01_1165 - 9267891-9268145,9268395-9268510,9268991-9269127, 9269645-9269808,9269892-9269972,9270783-9270962, 9271489-9271929,9273234-9273344,9274355-9274463, 9274618-9274643,9274823-9274903,9275013-9275211, 9275374-9275449,9275553-9275769,9276117-9276155, 9276684-9276783,9276962-9277084,9277171-9277895 Length = 1059 Score = 72.1 bits (169), Expect = 3e-13 Identities = 53/163 (32%), Positives = 77/163 (47%), Gaps = 3/163 (1%) Frame = +3 Query: 84 PTDFQVIVVGTGMVESIVAAACSRIGKNVLHMDSSDHYGGLWASHNFEGLQKFIKEVNSD 263 PT F V++ GTG+ ES++AAAC+ GK VLH+D + YG L++S L F+ SD Sbjct: 21 PTSFDVVLCGTGLPESVLAAACAAAGKTVLHVDPNPFYGSLFSSLPLPSLPSFLSPSPSD 80 Query: 264 PDRQKQVYNLSEKWFIEKESAQGETTDENKGEPRKVWSQADFAAEYRKFNIDTT-PKLLF 440 + + + + S E E G R+F D P+LL+ Sbjct: 81 DPAPSPSPSSAAAVDLRRRSPYSEV--ETSGA---------VPEPSRRFTADLVGPRLLY 129 Query: 441 SRGPLVELLISSNIARYAEFRCVT--RVLTWLNDQLMPVPCSR 563 V+LL+ S + + EF+ V +L W D L PVP SR Sbjct: 130 CADEAVDLLLRSGGSHHVEFKSVEGGTLLYWDGD-LYPVPDSR 171 >03_02_0544 - 9362615-9362674,9362783-9362857,9362934-9363144, 9363279-9363403,9363492-9363593,9363676-9363738, 9363817-9363897,9364248-9364359,9364454-9364626, 9364722-9364829,9364909-9364992,9365131-9365193, 9365652-9365738 Length = 447 Score = 48.8 bits (111), Expect = 3e-06 Identities = 25/60 (41%), Positives = 35/60 (58%) Frame = +3 Query: 90 DFQVIVVGTGMVESIVAAACSRIGKNVLHMDSSDHYGGLWASHNFEGLQKFIKEVNSDPD 269 ++ VIV+GTG+ E I++ S G VLHMD +D+YGG S N L K K + P+ Sbjct: 4 EYDVIVLGTGLKECIISGLLSVDGLKVLHMDRNDYYGGESTSLNLTKLWKRFKGNETAPE 63 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/81 (27%), Positives = 43/81 (53%), Gaps = 4/81 (4%) Frame = +3 Query: 330 GETTDENKGEPRKVWSQADFAAEY----RKFNIDTTPKLLFSRGPLVELLISSNIARYAE 497 GE+T N + K + + A E+ +++N+D PK + + G LV +LI +++ +Y Sbjct: 41 GESTSLNLTKLWKRFKGNETAPEHLGVSKEYNVDMVPKFMMANGALVRVLIHTSVTKYLN 100 Query: 498 FRCVTRVLTWLNDQLMPVPCS 560 F+ V + N ++ VP + Sbjct: 101 FKAVDGSFVYNNGKIHKVPAT 121 >05_04_0333 + 20333243-20333329,20335048-20335110,20335276-20335359, 20335720-20335827,20335969-20336141,20337135-20337246, 20337468-20337548,20337635-20337697,20337779-20337880, 20338070-20338194,20338317-20338527,20338625-20338699, 20338990-20339043 Length = 445 Score = 46.8 bits (106), Expect = 1e-05 Identities = 24/59 (40%), Positives = 34/59 (57%) Frame = +3 Query: 90 DFQVIVVGTGMVESIVAAACSRIGKNVLHMDSSDHYGGLWASHNFEGLQKFIKEVNSDP 266 ++ VIV+GTG+ E I++ S G VLHMD +D+YGG S N L K + + P Sbjct: 4 EYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPP 62 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = +3 Query: 402 RKFNIDTTPKLLFSRGPLVELLISSNIARYAEFRCVTRVLTWLNDQLMPVPCS 560 R +N+D PK + + G LV LI +++ +Y F+ V + ++ VP + Sbjct: 69 RDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPAT 121 >05_03_0407 + 13582595-13582681,13583067-13583129,13583289-13583372, 13583757-13583864,13584018-13584190,13585190-13585301, 13585424-13585504,13585611-13585673,13585764-13585865, 13586063-13586187,13586316-13586526,13586614-13586688, 13586950-13587003 Length = 445 Score = 46.8 bits (106), Expect = 1e-05 Identities = 24/59 (40%), Positives = 34/59 (57%) Frame = +3 Query: 90 DFQVIVVGTGMVESIVAAACSRIGKNVLHMDSSDHYGGLWASHNFEGLQKFIKEVNSDP 266 ++ VIV+GTG+ E I++ S G VLHMD +D+YGG S N L K + + P Sbjct: 4 EYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPP 62 Score = 36.7 bits (81), Expect = 0.013 Identities = 14/53 (26%), Positives = 28/53 (52%) Frame = +3 Query: 402 RKFNIDTTPKLLFSRGPLVELLISSNIARYAEFRCVTRVLTWLNDQLMPVPCS 560 + +N+D PK + + G LV LI +++ +Y F+ V + ++ VP + Sbjct: 69 KDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPAT 121 >07_01_1091 - 10015180-10015236,10015705-10015779,10015874-10016149, 10016204-10016332,10017070-10017171,10017626-10017688, 10017776-10017856,10018218-10018314,10019064-10019236, 10019327-10019434,10019706-10019789,10019985-10020047, 10020483-10020569 Length = 464 Score = 44.8 bits (101), Expect = 5e-05 Identities = 24/59 (40%), Positives = 33/59 (55%) Frame = +3 Query: 90 DFQVIVVGTGMVESIVAAACSRIGKNVLHMDSSDHYGGLWASHNFEGLQKFIKEVNSDP 266 ++ VIV+GTG+ E I++ S VLHMD +D+YGG S N L K K + P Sbjct: 4 EYDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEGTPP 62 Score = 37.1 bits (82), Expect = 0.010 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +3 Query: 402 RKFNIDTTPKLLFSRGPLVELLISSNIARYAEFRCVTRVLTWLNDQLMPVP 554 R +N+D PK + + G LV +LI + + +Y F+ V + ++ VP Sbjct: 69 RDYNVDMIPKFMMANGTLVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVP 119 >09_06_0256 + 21887666-21888670 Length = 334 Score = 31.1 bits (67), Expect = 0.64 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Frame = +3 Query: 69 MDEDFPTDFQVIVVGTGMVESIVAA-ACSRIGKNVLHMDSSDHYGGLWASHNFEGLQKFI 245 +D DF + Q+ G G + +V+A A I + + +++S H G A + I Sbjct: 161 VDADFVS--QLADAGPGALSELVSAYANGSIQEKLDKVENSGHVEGRAAESDVNVSSPRI 218 Query: 246 KEVNSDPDRQKQVYNLSEK 302 KE N D + +V+++S+K Sbjct: 219 KEANEDAEEVDKVWDMSKK 237 >09_04_0425 - 17448906-17449195,17449489-17449600 Length = 133 Score = 31.1 bits (67), Expect = 0.64 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -2 Query: 440 EQQLWSCINVKFPILRCKISLAPYFSWF 357 ++Q++ C ++ FP++ SL YF WF Sbjct: 44 QRQMFYCTHLNFPVMLATCSLKSYFLWF 71 >01_03_0044 - 11927272-11928516 Length = 414 Score = 30.7 bits (66), Expect = 0.85 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +3 Query: 90 DFQVIVVGTGMVESIVAAACSRIGKNVLHMDSSDHYGGLWASH 218 DF VIVVG G++ S A A + G L ++ D L +SH Sbjct: 20 DFDVIVVGAGIMGSCAAHAAASRGARALLLERFDLLHHLGSSH 62 >03_02_0127 + 5777564-5779879 Length = 771 Score = 29.1 bits (62), Expect = 2.6 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 2/93 (2%) Frame = +3 Query: 231 LQKFIKEVNSDPDRQKQVYNLSEKWFIEKESAQGETTDENKGEPRKVWSQADFAAEYRKF 410 LQ+ +E++ D ++ + LSE E +G T ++N + K Q + Sbjct: 562 LQQSPEELSEDEFYEEYDFELSELDESGTED-EGPTINKNSYDHLKADGQRPKRISALEQ 620 Query: 411 NIDT-TP-KLLFSRGPLVELLISSNIARYAEFR 503 + D+ TP KL F RG +VEL SN R +FR Sbjct: 621 DDDSATPYKLKFKRGKIVELQPDSNGPRKLKFR 653 >10_08_0894 - 21365629-21365766,21365849-21365950,21366042-21366284, 21366685-21366813,21366999-21367103,21367196-21367387, 21367486-21367639,21368148-21368209,21368291-21368437, 21368517-21368564,21369091-21369228,21369305-21369451, 21370579-21370665,21370754-21370861,21370941-21371041, 21371870-21371996,21372820-21372936,21373029-21373106, 21373240-21373284,21373637-21373756,21373838-21373964, 21374033-21374253,21374347-21374529,21374772-21374924, 21375051-21375146,21375226-21375331,21375410-21375492, 21375576-21375728,21375819-21376058,21376367-21376414, 21376782-21376928,21377007-21377115,21377200-21377345, 21377715-21377809,21377944-21378049,21378177-21378368, 21378456-21378686,21378772-21378866,21379426-21379529, 21380040-21380284,21380300-21380347,21380376-21380480, 21380630-21380767,21381458-21381649,21381738-21381914, 21382001-21382129,21382203-21382316,21382407-21382746, 21382836-21383064,21383155-21383455,21384311-21384358, 21387963-21388355 Length = 2493 Score = 28.3 bits (60), Expect = 4.5 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 276 KQVYNLSEKWFIEKESAQGET 338 +Q ++ EKW +EK +AQGET Sbjct: 664 RQSHSNLEKWLVEKLTAQGET 684 >10_08_0505 + 18384392-18384454,18384593-18384679,18385878-18386409, 18387042-18387564,18387734-18387791 Length = 420 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 198 GGLWA-SHNFEGLQKFIKEVNSDPDRQKQVYNLSEK 302 G W+ ++N + + E SDP++ K+V+ LSEK Sbjct: 358 GVYWSWNNNSASFENQLSEEASDPEKAKKVWELSEK 393 >06_03_1252 + 28753584-28753883,28754693-28754886,28755192-28755597 Length = 299 Score = 28.3 bits (60), Expect = 4.5 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +3 Query: 264 PDRQKQVYNLSEKWFIEKESAQGETTDENKGEPRKVWSQADFAAEYRKFNI 416 P RQ V+ + W E+ + QG G + WS+A F A YR++N+ Sbjct: 187 PTRQP-VHVFASIWNAEEWATQG-------GRVKTDWSRAPFVATYRRYNV 229 >10_01_0053 - 767131-767962,768517-769037,769384-769601,769720-769825, 769958-770017 Length = 578 Score = 27.9 bits (59), Expect = 6.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -3 Query: 169 TFLPILLQAAATMDSTMPVPTTMTWKSVGKSSSIILVYI 53 TFLPI + T+ ++ +P++MT G + VY+ Sbjct: 121 TFLPIYILGLLTLMASTSLPSSMTSSDAGHQLHSVAVYL 159 >05_03_0265 - 11293020-11293329,11293911-11294232,11294332-11294455 Length = 251 Score = 27.9 bits (59), Expect = 6.0 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = +3 Query: 90 DFQVIVVGTGMVESIVAAACSRIGKNVLHMDSSDHYGGLWASHNFEGLQKFIKEVNSDPD 269 D+ +V T + S V A S G N M S ++G W S+ + Q V D Sbjct: 166 DYFELVTVTNVGGSGVVAQMSIKGSNTGWMAMSRNWGANWQSNAYLAGQSLSFIVQLDDG 225 Query: 270 RQKQVYNLS-EKWF 308 R+ +N++ WF Sbjct: 226 RKVTAWNVAPSNWF 239 >03_05_0980 - 29384046-29384117,29384901-29384998,29385656-29385725, 29386260-29386391,29386823-29387083,29387266-29387336, 29387520-29387587,29388676-29388869 Length = 321 Score = 27.9 bits (59), Expect = 6.0 Identities = 19/78 (24%), Positives = 36/78 (46%) Frame = +3 Query: 99 VIVVGTGMVESIVAAACSRIGKNVLHMDSSDHYGGLWASHNFEGLQKFIKEVNSDPDRQK 278 V V+GT + E +++ R + + GGL A + L K E++S + +K Sbjct: 101 VDVMGTRLAEEVLSLVQRRPELQKISFVAHS-LGGLIARYAIALLYKSATEIDSHEEHEK 159 Query: 279 QVYNLSEKWFIEKESAQG 332 Q+ ++S I++ G Sbjct: 160 QITDVSSNQLIDRGKIAG 177 >01_06_0893 - 32766994-32768841,32769596-32769782,32769860-32769987, 32770080-32770283,32770373-32770523,32771424-32771533, 32772534-32772903,32773031-32773189,32773719-32773848, 32773921-32773989,32774066-32774154,32774319-32774439, 32775878-32776148 Length = 1278 Score = 27.9 bits (59), Expect = 6.0 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +3 Query: 213 SHNFEGLQKFIKEVNSDPDRQKQVYNLSEKWFIEKE--SAQGETTDENKGEPRK 368 SH F G++ +E + +++ + E W +E E +G TT+++K +K Sbjct: 436 SHIFSGIEVAYQEAVALKRQEELIREEEEAWLLENEMKGKRGSTTEKDKRAKKK 489 >11_05_0095 + 19009866-19010159,19010255-19010448,19012183-19012582 Length = 295 Score = 27.5 bits (58), Expect = 7.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 354 GEPRKVWSQADFAAEYRKFNID 419 G + WS+A F A YR F++D Sbjct: 207 GREKTDWSRAPFVASYRGFHVD 228 >06_01_1115 - 9186521-9187000 Length = 159 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 501 GTQRSARCSKRSEARQGGRERT 436 G +R RC +R+ A +GGRE T Sbjct: 21 GEERLPRCGRRATAWRGGREAT 42 >04_04_0476 - 25508952-25509004,25509245-25509326,25509453-25509611, 25509702-25509767,25509898-25510067,25510172-25510262, 25510331-25510410,25510887-25511003,25511092-25511218, 25511685-25511865,25511978-25512366,25512959-25513135, 25513306-25513500,25513844-25514031,25514192-25514500, 25514592-25514637 Length = 809 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +3 Query: 225 EGLQKFIKEVNSDPDRQKQVYNLSEKWFIEKESAQGETTDENKGEPR 365 + LQ +EV D+Q++ L+E W +K+ + T ++ + E R Sbjct: 757 QALQNSGQEVCVSIDKQREKRRLAENWRRKKQKEKKSTREQKRKEKR 803 >03_02_0232 + 6614784-6614882,6616145-6616477,6616708-6616967, 6617328-6617469,6617567-6617938,6618056-6618187, 6618907-6619035,6619125-6621188 Length = 1176 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 297 EKWFIEKESAQGETTDENKGEPRKVWSQAD 386 + + + KES G T +N G P++VW D Sbjct: 742 DNFIVSKESRTGNTQQKN-GAPKQVWEPMD 770 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,253,964 Number of Sequences: 37544 Number of extensions: 329419 Number of successful extensions: 939 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1305140760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -