BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12f02r (349 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF136170-1|AAP97260.1| 63|Homo sapiens cytochrome c oxidase VI... 55 7e-08 X16560-1|CAA34559.1| 63|Homo sapiens protein ( Human COX VIIc ... 51 9e-07 BT007098-1|AAP35762.1| 63|Homo sapiens cytochrome c oxidase su... 51 9e-07 BC007498-1|AAH07498.1| 63|Homo sapiens cytochrome c oxidase su... 51 9e-07 BC001005-1|AAH01005.1| 63|Homo sapiens cytochrome c oxidase su... 51 9e-07 AF067639-1|AAC73062.1| 63|Homo sapiens cytochrome c oxidase su... 51 9e-07 >AF136170-1|AAP97260.1| 63|Homo sapiens cytochrome c oxidase VIIc protein. Length = 63 Score = 54.8 bits (126), Expect = 7e-08 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = -3 Query: 209 PGENLPFDINNKARLTFHMFWFFGSGFAAPFLVVWHQMRK 90 PG+NLPF + NK RL M +FGSGFAAPF +V HQ+ K Sbjct: 23 PGKNLPFSVENKWRLLAMMTVYFGSGFAAPFFIVRHQLLK 62 >X16560-1|CAA34559.1| 63|Homo sapiens protein ( Human COX VIIc gene for subunit VIIc of cytochrome c oxidase (EC 1.9.3.1). ). Length = 63 Score = 51.2 bits (117), Expect = 9e-07 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -3 Query: 209 PGENLPFDINNKARLTFHMFWFFGSGFAAPFLVVWHQMRK 90 PG+NLPF + NK L M +FGS FA PFLVV HQ+ K Sbjct: 23 PGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLK 62 >BT007098-1|AAP35762.1| 63|Homo sapiens cytochrome c oxidase subunit VIIc protein. Length = 63 Score = 51.2 bits (117), Expect = 9e-07 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -3 Query: 209 PGENLPFDINNKARLTFHMFWFFGSGFAAPFLVVWHQMRK 90 PG+NLPF + NK L M +FGS FA PFLVV HQ+ K Sbjct: 23 PGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLK 62 >BC007498-1|AAH07498.1| 63|Homo sapiens cytochrome c oxidase subunit VIIc protein. Length = 63 Score = 51.2 bits (117), Expect = 9e-07 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -3 Query: 209 PGENLPFDINNKARLTFHMFWFFGSGFAAPFLVVWHQMRK 90 PG+NLPF + NK L M +FGS FA PFLVV HQ+ K Sbjct: 23 PGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLK 62 >BC001005-1|AAH01005.1| 63|Homo sapiens cytochrome c oxidase subunit VIIc protein. Length = 63 Score = 51.2 bits (117), Expect = 9e-07 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -3 Query: 209 PGENLPFDINNKARLTFHMFWFFGSGFAAPFLVVWHQMRK 90 PG+NLPF + NK L M +FGS FA PFLVV HQ+ K Sbjct: 23 PGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLK 62 >AF067639-1|AAC73062.1| 63|Homo sapiens cytochrome c oxidase subunit VIIc precursor protein. Length = 63 Score = 51.2 bits (117), Expect = 9e-07 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -3 Query: 209 PGENLPFDINNKARLTFHMFWFFGSGFAAPFLVVWHQMRK 90 PG+NLPF + NK L M +FGS FA PFLVV HQ+ K Sbjct: 23 PGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLK 62 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,258,680 Number of Sequences: 237096 Number of extensions: 1002984 Number of successful extensions: 6023 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6023 length of database: 76,859,062 effective HSP length: 80 effective length of database: 57,891,382 effective search space used: 2026198370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -