BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12f02f (401 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 25 0.24 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 3.0 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 6.9 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 6.9 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 20 9.2 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 20 9.2 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 25.4 bits (53), Expect = 0.24 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +3 Query: 96 NVVKTSVRSGSNGGIPGENLPFDINNKARLTFHMFWFFGSGFAAPF 233 NV+K + SG+ + F +N+ RLTF GF PF Sbjct: 941 NVIKLTKTSGTVQAQINPDFAFIVNSNLRLTFSKNVQGRVGFVTPF 986 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.8 bits (44), Expect = 3.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 104 YDILPNGPVGNPCNCSDHFDFP*LISGLN 18 +D+LP+ P SD+F F L + LN Sbjct: 264 WDVLPHPPYSPDLAPSDYFLFRSLQNSLN 292 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 20.6 bits (41), Expect = 6.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 102 VKTSVRSGSNGGIPGENLPFDINNK 176 +KT + +G N IP E + N+K Sbjct: 304 IKTELSTGMNDDIPPETEEEEENDK 328 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 20.6 bits (41), Expect = 6.9 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +2 Query: 74 FQQDRWEECRK 106 + +DRWEE R+ Sbjct: 17 YGEDRWEEIRR 27 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 20.2 bits (40), Expect = 9.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 152 ILPGNTAVGSTPNTGLYDILPNGPVG 75 ++ GN+ +T G+YDIL +G Sbjct: 367 VIEGNSDSINTKFYGMYDILARDILG 392 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 20.2 bits (40), Expect = 9.2 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 83 PVGNPCNCSDH 51 PVG+P N S H Sbjct: 1762 PVGHPTNASAH 1772 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,751 Number of Sequences: 438 Number of extensions: 2324 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10008927 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -