BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12e23r (708 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 44 1e-06 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 3.7 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 3.7 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 3.7 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 22 5.0 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 6.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.6 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 8.7 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 8.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.7 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 44.0 bits (99), Expect = 1e-06 Identities = 27/88 (30%), Positives = 49/88 (55%), Gaps = 2/88 (2%) Frame = -1 Query: 270 RQVSLQVITNAVCARTFGNNVIIASTLCVDGSNGRSTCSGDSGGPLTIGSGGSRQL--IG 97 ++ +L ++T C + +GN I+ + +C + G+ C DSGGP+ + +++L IG Sbjct: 311 QKTTLNMLTQVECYKYYGN--IMVNAMCAY-AKGKDACQMDSGGPVLWQNPRTKRLVNIG 367 Query: 96 ITSFGSAQGCQRGHPAGFARVTSFNSWI 13 I S+G+ G +P G +V S+ WI Sbjct: 368 IISWGAECG---KYPNGNTKVGSYIDWI 392 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 3.7 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = -2 Query: 659 CWTCDRTDEWQ 627 CW CD+ +E++ Sbjct: 467 CWVCDQCEEYE 477 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 397 LHQQHPAHQPSQWKQQ 350 +H QHP QP Q + Q Sbjct: 172 MHTQHPHMQPQQGQHQ 187 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 3.7 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = -2 Query: 659 CWTCDRTDEWQ 627 CW CD+ +E++ Sbjct: 557 CWVCDQCEEYE 567 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 22.2 bits (45), Expect = 5.0 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = -3 Query: 112 PSTDRYHIVRISSRL 68 P+T+ Y+I+ +++RL Sbjct: 116 PNTEEYYIIEVNARL 130 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 567 CWRTRRAQARQFTLALGTANI 505 CW TR+ Q +GT+N+ Sbjct: 459 CWDTRKEYIPQNLGVIGTSNL 479 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 290 EPTTNKNAK*ASRS 249 EP TNKN K SRS Sbjct: 239 EPGTNKNGKFFSRS 252 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 6.6 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = +1 Query: 487 PGAS---GEDVSCAKSEGELTSLGSPG 558 PG S GE S A ++G T+ SPG Sbjct: 893 PGCSSKNGEPTSAAFAQGFATAASSPG 919 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 631 HSSVRSQVQQDGGEHXRWRQNHPQ 702 HSS ++Q QQ + + +Q PQ Sbjct: 1495 HSSQKTQQQQPQQQQQQQQQQQPQ 1518 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -1 Query: 456 SYNMDTLHNDVAIINHNHVGFTNN 385 S + +T+HN+ N+N+ + NN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -1 Query: 456 SYNMDTLHNDVAIINHNHVGFTNN 385 S + +T+HN+ N+N+ + NN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 8.7 Identities = 12/49 (24%), Positives = 18/49 (36%) Frame = +2 Query: 98 PIS*RLPPLPMVRGPPESPLQVLRPLEPSTQRVEAMITLFPNVRAQTAL 244 P+S +PP P + P++ P P + P V T L Sbjct: 759 PLSVSIPPPPSAQNVPQNTNSQAIPRIPILPMIPVYCVPVPQVNDSTIL 807 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.316 0.135 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,702 Number of Sequences: 438 Number of extensions: 3839 Number of successful extensions: 26 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -