BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12e11r (337 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31812.1 68414.m03905 acyl-CoA binding protein / ACBP identic... 65 1e-11 At3g05420.2 68416.m00594 acyl-CoA binding family protein similar... 50 3e-07 At3g05420.1 68416.m00593 acyl-CoA binding family protein similar... 50 3e-07 At5g27630.1 68418.m03310 acyl-CoA binding family protein similar... 50 4e-07 At5g53470.1 68418.m06645 acyl-CoA binding protein, putative / AC... 45 1e-05 At4g27780.1 68417.m03990 acyl-CoA binding protein 2 (ACBP2) iden... 44 3e-05 At4g24230.2 68417.m03478 acyl-CoA binding protein, putative / AC... 41 2e-04 At4g24230.1 68417.m03477 acyl-CoA binding protein, putative / AC... 41 2e-04 At1g51355.1 68414.m05776 expressed protein 36 0.007 At5g55770.1 68418.m06951 DC1 domain-containing protein contains ... 31 0.14 At4g03170.1 68417.m00433 hypothetical protein 31 0.19 At3g47700.1 68416.m05196 chromosome structural maintenance prote... 30 0.33 At4g00300.1 68417.m00037 fringe-related protein + weak similarit... 29 0.77 At1g33250.1 68414.m04110 fringe-related protein + weak similarit... 29 0.77 At1g78370.1 68414.m09133 glutathione S-transferase, putative sim... 29 1.0 At1g55560.1 68414.m06359 multi-copper oxidase type I family prot... 29 1.0 At1g20600.1 68414.m02573 DNA-binding protein-related low similar... 29 1.0 At5g06850.1 68418.m00774 C2 domain-containing protein contains I... 28 1.3 At2g24010.1 68415.m02868 serine carboxypeptidase S10 family prot... 28 1.3 At5g35604.1 68418.m04242 hypothetical protein 27 2.4 At3g26750.1 68416.m03346 expressed protein 27 2.4 At3g09810.1 68416.m01169 isocitrate dehydrogenase, putative / NA... 27 2.4 At1g53680.1 68414.m06108 glutathione S-transferase, putative sim... 27 2.4 At5g16750.1 68418.m01961 transducin family protein / WD-40 repea... 27 3.1 At3g13400.1 68416.m01685 multi-copper oxidase type I family prot... 27 3.1 At1g60610.2 68414.m06823 expressed protein 27 3.1 At1g60610.1 68414.m06822 expressed protein 27 3.1 At1g32850.1 68414.m04048 ubiquitin carboxyl-terminal hydrolase f... 27 3.1 At3g13390.1 68416.m01684 multi-copper oxidase type I family prot... 27 4.1 At4g33910.1 68417.m04812 oxidoreductase, 2OG-Fe(II) oxygenase fa... 26 5.4 At3g61740.1 68416.m06923 PHD finger family protein (ATX3) contai... 26 5.4 At2g23096.1 68415.m02755 oxidoreductase, 2OG-Fe(II) oxygenase fa... 26 5.4 At1g55570.1 68414.m06360 multi-copper oxidase type I family prot... 26 5.4 At1g16370.1 68414.m01958 transporter-related low similarity to o... 26 5.4 At5g55780.1 68418.m06952 DC1 domain-containing protein contains ... 26 7.2 At5g48060.1 68418.m05938 C2 domain-containing protein contains I... 26 7.2 At5g08470.1 68418.m00999 peroxisome biogenesis protein (PEX1) id... 26 7.2 At4g10370.1 68417.m01702 DC1 domain-containing protein contains ... 26 7.2 At5g46660.1 68418.m05749 CHP-rich zinc finger protein, putative ... 25 9.5 At4g02180.1 68417.m00290 DC1 domain-containing protein contains ... 25 9.5 At3g20660.1 68416.m02615 organic cation transporter family prote... 25 9.5 At3g10360.1 68416.m01242 pumilio/Puf RNA-binding domain-containi... 25 9.5 At2g25570.1 68415.m03062 expressed protein 25 9.5 At2g23180.1 68415.m02769 cytochrome P450, putative 25 9.5 At1g55380.1 68414.m06334 DC1 domain-containing protein contains ... 25 9.5 >At1g31812.1 68414.m03905 acyl-CoA binding protein / ACBP identical to acyl-CoA-binding protein (ACBP) [Arabidopsis thaliana] SWISS-PROT:P57752 Length = 92 Score = 65.3 bits (152), Expect = 1e-11 Identities = 32/82 (39%), Positives = 48/82 (58%), Gaps = 2/82 (2%) Frame = -2 Query: 303 MSLDEQFKQVADKVRNWKTKPSDDENLALYSLYKQATIGDVNIAQPS--GLVESAKWKAW 130 M L E+F++ A+KV PS+++ L LY LYKQA G V+ ++P + E AKW AW Sbjct: 1 MGLKEEFEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAW 60 Query: 129 NGRKGISQDDAKKQYIENAEKL 64 +G S ++A YI ++L Sbjct: 61 KAVEGKSSEEAMNDYITKVKQL 82 >At3g05420.2 68416.m00594 acyl-CoA binding family protein similar to PIR|S68824|S68824 rngB protein, cytosolic (Dictyostelium discoideum); contains Pfam profiles PF00887: Acyl CoA binding protein, PF01344: Kelch motif Length = 669 Score = 50.4 bits (115), Expect = 3e-07 Identities = 25/67 (37%), Positives = 40/67 (59%), Gaps = 2/67 (2%) Frame = -2 Query: 261 RNWKTKPSDDENLALYSLYKQATIGDVNIAQPSGL--VESAKWKAWNGRKGISQDDAKKQ 88 +N +K DD L LY+LY+QAT+G N +PS VE +KWK+W G + +A + Sbjct: 33 KNVISKFPDDTALLLYALYQQATVGPCNTPKPSAWRPVEQSKWKSWQGLGTMPSIEAMRL 92 Query: 87 YIENAEK 67 +++ E+ Sbjct: 93 FVKILEE 99 >At3g05420.1 68416.m00593 acyl-CoA binding family protein similar to PIR|S68824|S68824 rngB protein, cytosolic (Dictyostelium discoideum); contains Pfam profiles PF00887: Acyl CoA binding protein, PF01344: Kelch motif Length = 668 Score = 50.4 bits (115), Expect = 3e-07 Identities = 25/67 (37%), Positives = 40/67 (59%), Gaps = 2/67 (2%) Frame = -2 Query: 261 RNWKTKPSDDENLALYSLYKQATIGDVNIAQPSGL--VESAKWKAWNGRKGISQDDAKKQ 88 +N +K DD L LY+LY+QAT+G N +PS VE +KWK+W G + +A + Sbjct: 33 KNVISKFPDDTALLLYALYQQATVGPCNTPKPSAWRPVEQSKWKSWQGLGTMPSIEAMRL 92 Query: 87 YIENAEK 67 +++ E+ Sbjct: 93 FVKILEE 99 >At5g27630.1 68418.m03310 acyl-CoA binding family protein similar to RING finger rngB protein, cytosolic - Dictyostelium discoideum, PIR:S68824; contains Pfam profiles PF01344: Kelch motif, PF00887: Acyl CoA binding protein (ACBP) Length = 648 Score = 50.0 bits (114), Expect = 4e-07 Identities = 24/68 (35%), Positives = 43/68 (63%), Gaps = 2/68 (2%) Frame = -2 Query: 264 VRNWKTKPSDDENLALYSLYKQATIGDVNIAQPSGL--VESAKWKAWNGRKGISQDDAKK 91 V+ +K S+D +L LY+L++QAT+G +I +PS VE +KWK+W G + +A + Sbjct: 33 VKQLSSKFSNDTSLLLYTLHQQATLGPCSIPKPSAWNPVEQSKWKSWQGLGTMPSIEAMR 92 Query: 90 QYIENAEK 67 +++ E+ Sbjct: 93 LFVKILEE 100 >At5g53470.1 68418.m06645 acyl-CoA binding protein, putative / ACBP, putative similar to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 338 Score = 44.8 bits (101), Expect = 1e-05 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = -2 Query: 246 KPSDDENLALYSLYKQATIGDVNIAQPSGL--VESAKWKAWNGRKGISQDDAKKQYIENA 73 K S++ L LY LYK AT G QPS L AKW+AW + ++A ++YI+ Sbjct: 116 KVSNELQLQLYGLYKIATEGPCTAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIDLV 175 Query: 72 EKLH 61 +L+ Sbjct: 176 TQLY 179 >At4g27780.1 68417.m03990 acyl-CoA binding protein 2 (ACBP2) identical to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 354 Score = 43.6 bits (98), Expect = 3e-05 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = -2 Query: 243 PSDDENLALYSLYKQATIGDVNIAQPSGL--VESAKWKAWNGRKGISQDDAKKQYIENAE 70 PSD + LY LYK AT G QPS L AKW+AW + ++A ++YIE Sbjct: 128 PSDVQQ-QLYGLYKIATEGPCTAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIEIVT 186 Query: 69 KLH 61 +L+ Sbjct: 187 QLY 189 >At4g24230.2 68417.m03478 acyl-CoA binding protein, putative / ACBP, putative contains similarity to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 362 Score = 41.1 bits (92), Expect = 2e-04 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = -2 Query: 234 DENLALYSLYKQATIGDVNIAQPSGLVESA--KWKAWNGRKGISQDDAKKQYIENAEK 67 + + L+ L+K AT G AQP ++ SA KW AW +SQ++A +QY+ K Sbjct: 254 EAKMELFGLHKIATEGSCREAQPMAVMISARAKWNAWQKLGNMSQEEAMEQYLALVSK 311 >At4g24230.1 68417.m03477 acyl-CoA binding protein, putative / ACBP, putative contains similarity to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 364 Score = 41.1 bits (92), Expect = 2e-04 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = -2 Query: 234 DENLALYSLYKQATIGDVNIAQPSGLVESA--KWKAWNGRKGISQDDAKKQYIENAEK 67 + + L+ L+K AT G AQP ++ SA KW AW +SQ++A +QY+ K Sbjct: 254 EAKMELFGLHKIATEGSCREAQPMAVMISARAKWNAWQKLGNMSQEEAMEQYLALVSK 311 >At1g51355.1 68414.m05776 expressed protein Length = 116 Score = 35.9 bits (79), Expect = 0.007 Identities = 19/49 (38%), Positives = 29/49 (59%) Frame = -3 Query: 311 NTKCLSTSNSNRSPIRLGTGRPSPVTMRTLRCTPCTSRLP*VMLTLPSP 165 N+ STS+++ SP T PSPV+ + CTP SR+P ++ P+P Sbjct: 32 NSDVTSTSSTSTSPT--STATPSPVSAESGCCTPEKSRIPEMLTCPPAP 78 >At5g55770.1 68418.m06951 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 695 Score = 31.5 bits (68), Expect = 0.14 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = -1 Query: 157 CGERQVEGMERSQRHLPRRCQEAIHRKCGETPLQIR 50 CG + + ++ S+ + +CQ HR+C E+PL+I+ Sbjct: 156 CGACKGKMLDTSKDYACLQCQRKFHRECVESPLEIK 191 >At4g03170.1 68417.m00433 hypothetical protein Length = 250 Score = 31.1 bits (67), Expect = 0.19 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 186 DVNIAQPSGLVESAKWKAWNGRKGISQDDAKKQYIEN 76 DV++ P G V+ ++K WNG K KQ++E+ Sbjct: 178 DVSVYGPDGKVQQMEFKMWNGDKTPVLTSGWKQFVED 214 >At3g47700.1 68416.m05196 chromosome structural maintenance protein-related contains weak similarity to RAD50-interacting protein 1 [Homo sapiens] gi|11967435|gb|AAG42101 Length = 795 Score = 30.3 bits (65), Expect = 0.33 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = -2 Query: 306 KMSLDEQ---FKQVADKVRNWKTKPSDDENLALYSLYKQATIGDVNIAQPSGLVESAK 142 ++ LDE+ FK+ D RNW K DE ++ ++Y+ I + + S ++E +K Sbjct: 456 EIELDERLVKFKEEIDNDRNWTAK-VQDELISSSNVYRPPIISSIFLQHLSSIIERSK 512 >At4g00300.1 68417.m00037 fringe-related protein + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 785 Score = 29.1 bits (62), Expect = 0.77 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 8/77 (10%) Frame = +2 Query: 56 LEWSFSAFSMYCFL-ASSWEMPLRPFHAFHL-------ALSTRPLGWAMLTSPMVACLYR 211 + W ++ ++ A E+P R F+ +HL A +TRP+ W P V Sbjct: 356 ISWGYTVQITRTYMPARMMEVPTRTFNDWHLRSDFTNLAFNTRPVTWTDCQRPRVFYFSH 415 Query: 212 EYSARFSSSLGLVFQFL 262 +S SS + Q+L Sbjct: 416 AFSNSSSSDTTTISQYL 432 >At1g33250.1 68414.m04110 fringe-related protein + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 548 Score = 29.1 bits (62), Expect = 0.77 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 93 SWHRLGRCLCDRSMPSTWRSPQDRWAGQC 179 +WH R LC R+ P+T P GQC Sbjct: 508 NWHLAPRRLCCRATPTTTNEPLRLTVGQC 536 >At1g78370.1 68414.m09133 glutathione S-transferase, putative similar to 2,4-D inducible glutathione S-transferase GI:2920666 from [Glycine max] Length = 217 Score = 28.7 bits (61), Expect = 1.0 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = -2 Query: 147 AKWKAWNGRKGISQDDAKKQYIENAEKLHSK 55 A++K W G+KG Q+ KK++IE + L S+ Sbjct: 109 AQFKVW-GKKGEEQEAGKKEFIEAVKILESE 138 >At1g55560.1 68414.m06359 multi-copper oxidase type I family protein similar to pollen-specific BP10 protein [SP|Q00624][Brassica napus]; contains Pfam profile: PF00394 Multicopper oxidase Length = 549 Score = 28.7 bits (61), Expect = 1.0 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 181 NITYGSLLVQGVQRKVLIVTGLGLPVPNL 267 N+TYG+ GV +KV+++ G P PNL Sbjct: 31 NVTYGTASPLGVPQKVILING-QFPGPNL 58 >At1g20600.1 68414.m02573 DNA-binding protein-related low similarity to RAV2 [Arabidopsis thaliana] GI:3868859 Length = 237 Score = 28.7 bits (61), Expect = 1.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 186 DVNIAQPSGLVESAKWKAWNGRK 118 DV++ P G V+ K+K WNG K Sbjct: 167 DVSVYGPDGEVQQMKFKMWNGDK 189 >At5g06850.1 68418.m00774 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 669 Score = 28.3 bits (60), Expect = 1.3 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = +2 Query: 41 IIYAYLEWSFSAFSMYCFLASSWEMPLRPFHAFHLALSTRPLGWAMLTSP 190 I+ Y E +Y FL W RP H H + T+ + WA SP Sbjct: 505 ILICYPELILPTTFLYMFLIGLWNFRFRPRHPAH--MDTK-VSWAEAASP 551 >At2g24010.1 68415.m02868 serine carboxypeptidase S10 family protein similar to Serine carboxypeptidase II chains A and B (SP:P08819) (EC 3.4.16.6) [Triticum aestivum (Wheat)]; Length = 425 Score = 28.3 bits (60), Expect = 1.3 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = -2 Query: 309 HKMSLDEQFKQVADKVRNWKTKPSDDENLALYSLYKQ-ATIGDVNIAQPSGLVESAKWKA 133 H M D+ +K + K SD N ALY Y++ + +I PS + ++ + K Sbjct: 203 HAMISDKTYKSILKHCSFTADKTSDKCNWALYFAYREFGKVNGYSIYSPSCVHQTNQTKF 262 Query: 132 WNGR 121 +GR Sbjct: 263 LHGR 266 >At5g35604.1 68418.m04242 hypothetical protein Length = 298 Score = 27.5 bits (58), Expect = 2.4 Identities = 23/81 (28%), Positives = 35/81 (43%) Frame = -3 Query: 278 RSPIRLGTGRPSPVTMRTLRCTPCTSRLP*VMLTLPSPAVLWRAPSGRHGTVAKASPKTM 99 RSP R G SP + T C+ RL T+ P + +PS + + K T+ Sbjct: 69 RSPRRPSRGNSSPRRDKARARTDCSPRLSPPSRTMGPPPPVATSPSSQ-WSGEKTDHNTV 127 Query: 98 PRSNTSKMRRNSTPNTHKLLL 36 P+ + R TP K++L Sbjct: 128 PQKEGGEHR--DTPPRSKVVL 146 >At3g26750.1 68416.m03346 expressed protein Length = 526 Score = 27.5 bits (58), Expect = 2.4 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +3 Query: 75 HFRCIASWHRLGRC-LCDRS-MPS-TWRSPQDRWAGQC 179 HF C + +RL + L D S MPS WR D W G C Sbjct: 156 HFYCRSCSNRLTKKELLDFSEMPSINWRESADNWFGTC 193 >At3g09810.1 68416.m01169 isocitrate dehydrogenase, putative / NAD+ isocitrate dehydrogenase, putative strong similarity to isocitrate dehydrogenase (NAD+) GB:CAA65502 GI:3021506 [Nicotiana tabacum] Length = 374 Score = 27.5 bits (58), Expect = 2.4 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 2/101 (1%) Frame = +1 Query: 19 EIYL--ILSNNLCVFGVEFLRIFDVLLLGIVLGDAFATVPCLPLGALHKTAGLGNVNITY 192 EIY ++ +N C+ V+ +FDVL++ + GD + + +G L T + N+ Sbjct: 236 EIYYEKVVIDNCCMMLVKNPALFDVLVMPNLYGDIISDLCAGLVGGLGLTPSM-NIG-ED 293 Query: 193 GSLLVQGVQRKVLIVTGLGLPVPNLIGDLFELLVERHFVLS 315 G L + V + G+ L P + L +++ RH L+ Sbjct: 294 GIALAEAVHGSAPDIAGMNLANPTAL-LLSGVMMLRHLKLN 333 >At1g53680.1 68414.m06108 glutathione S-transferase, putative similar to GI:2853219 from [Carica papaya] Length = 224 Score = 27.5 bits (58), Expect = 2.4 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -2 Query: 138 KAWNGRKGISQDDAKKQYIENAEKLHSK 55 K W +KG Q+ KK+++E+ + L ++ Sbjct: 116 KIWGNKKGEEQEKGKKEFLESLKVLEAE 143 >At5g16750.1 68418.m01961 transducin family protein / WD-40 repeat family protein contains 8 WD-40 repeats (PF00400); similar to transducin homolog sazD - Homo sapiens, EMBL:U02609 Length = 876 Score = 27.1 bits (57), Expect = 3.1 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 291 EQFKQVADKVRNWKTKPSDDENLALYSLYKQATI-GDVNIAQPSGLVE 151 E+F+ + + VR W TKP ++A + LYK I I Q G+ E Sbjct: 729 EEFRLLFEYVREWNTKPKLC-HIAQFVLYKTFNILPPTEIVQVKGIGE 775 >At3g13400.1 68416.m01685 multi-copper oxidase type I family protein similar to pollen-specific BP10 protein [SP|Q00624][Brassica napus]; contains Pfam profile: PF00394 Multicopper oxidase Length = 551 Score = 27.1 bits (57), Expect = 3.1 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 181 NITYGSLLVQGVQRKVLIVTGLGLPVPNL 267 N+TYG+ G+ ++V+++ G P PNL Sbjct: 32 NVTYGTAAPLGIPQQVILING-QFPGPNL 59 >At1g60610.2 68414.m06823 expressed protein Length = 340 Score = 27.1 bits (57), Expect = 3.1 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 3/75 (4%) Frame = -2 Query: 297 LDEQFKQVADKVRNWKTKPSDDE---NLALYSLYKQATIGDVNIAQPSGLVESAKWKAWN 127 L ++ KQVA + +NW K +E N +L + + G+ N A G+ + + K Sbjct: 207 LVDKIKQVAVEAQNWHYKAKYNESVVNALKVNLQQVMSHGNDNNAVGGGVADHHQMKEGF 266 Query: 126 GRKGISQDDAKKQYI 82 G I + A Y+ Sbjct: 267 GDSEIDDEAASYNYL 281 >At1g60610.1 68414.m06822 expressed protein Length = 340 Score = 27.1 bits (57), Expect = 3.1 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 3/75 (4%) Frame = -2 Query: 297 LDEQFKQVADKVRNWKTKPSDDE---NLALYSLYKQATIGDVNIAQPSGLVESAKWKAWN 127 L ++ KQVA + +NW K +E N +L + + G+ N A G+ + + K Sbjct: 207 LVDKIKQVAVEAQNWHYKAKYNESVVNALKVNLQQVMSHGNDNNAVGGGVADHHQMKEGF 266 Query: 126 GRKGISQDDAKKQYI 82 G I + A Y+ Sbjct: 267 GDSEIDDEAASYNYL 281 >At1g32850.1 68414.m04048 ubiquitin carboxyl-terminal hydrolase family protein similar to ubiquitin-specific protease UBP5 [Arabidopsis thaliana] GI:6648604; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 892 Score = 27.1 bits (57), Expect = 3.1 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = -2 Query: 240 SDDENLALYSLYKQATIGDV--NIAQPSGLV-ESAK-WKAWNGRKGISQDDAKKQYIENA 73 S DE+ + L KQA+IG + + G+ E A+ W + +K + D + +Q +E A Sbjct: 155 SRDESTTIIRLSKQASIGQLYEMVCAGKGVAKEKARIWDYFEKKKSVLLDPSSEQSVEEA 214 >At3g13390.1 68416.m01684 multi-copper oxidase type I family protein nearly identical to pollen-specific BP10 protein [SP|Q00624][Brassica napus]; contains Multicopper oxidase domain PF00394 Length = 554 Score = 26.6 bits (56), Expect = 4.1 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +1 Query: 181 NITYGSLLVQGVQRKVLIVTGLGLPVPNL 267 N+TYG++ GV ++V+++ G P PN+ Sbjct: 33 NVTYGTVSPLGVPQQVILING-QFPGPNV 60 >At4g33910.1 68417.m04812 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to prolyl 4-hydroxylase, alpha subunit, from Gallus gallus [GI:212530], Rattus norvegicus [GI:474940], Drosophila melanogaster [GI:4336512]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 288 Score = 26.2 bits (55), Expect = 5.4 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = -2 Query: 252 KTKPSDDENLALYSLYKQATIGDVNIAQPSGLVESAKWKA 133 K KP + L YS++ TI ++ + + KW A Sbjct: 238 KVKPRKGDGLLFYSVFPNGTIDQTSLHGSCPVTKGEKWVA 277 >At3g61740.1 68416.m06923 PHD finger family protein (ATX3) contains Pfam domains PF00628: PHD-finger and PF00855: PWWP domain; identical to cDNA trithorax 3 (ATX3) partial cds GI:15217142 Length = 799 Score = 26.2 bits (55), Expect = 5.4 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 148 RQVEGMERSQRHLPRRCQEAIHRKC 74 R VE E ++ + RCQ A+H++C Sbjct: 497 RWVEDWEENKMIICNRCQVAVHQEC 521 >At2g23096.1 68415.m02755 oxidoreductase, 2OG-Fe(II) oxygenase family protein contains Pfam profile: PF03171 oxidoreductase, 2OG-Fe(II) oxygenase family Length = 274 Score = 26.2 bits (55), Expect = 5.4 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = -2 Query: 270 DKVRNWKTKPSDDENLALYSLYKQATIGDVNIAQPSGLVESAKWKA 133 +K K KP + + Y+L+ TI ++ +++ KW A Sbjct: 219 EKCVGLKVKPRQGDAIFFYNLFPNGTIDQTSLHGSCPVIKGEKWVA 264 >At1g55570.1 68414.m06360 multi-copper oxidase type I family protein nearly identical to pollen-specific BP10 protein [SP|Q00624][Brassica napus]; contains Multicopper oxidase domain PF00394 Length = 555 Score = 26.2 bits (55), Expect = 5.4 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 181 NITYGSLLVQGVQRKVLIVTGLGLPVPNL 267 N+TYG+ GV ++V+++ G P PN+ Sbjct: 34 NVTYGTASPLGVPQQVILING-QFPGPNI 61 >At1g16370.1 68414.m01958 transporter-related low similarity to organic cation transporter OCTN1 from [Homo sapiens] GI:2605501, [Mus musculus] GI:4126605, [Rattus norvegicus] GI:5679326; contains Pfam profile PF00083: major facilitator superfamily protein Length = 521 Score = 26.2 bits (55), Expect = 5.4 Identities = 13/55 (23%), Positives = 27/55 (49%) Frame = +3 Query: 3 SII*VGNLFNSK**FMRIWSGVSPHFRCIASWHRLGRCLCDRSMPSTWRSPQDRW 167 S++ + LF+++ F+ +++ P +WH L +CD S + P+ W Sbjct: 50 SLVGLALLFDAQQIFITVYTDAYP------TWHCLNHTICDPSASDICKLPRSAW 98 >At5g55780.1 68418.m06952 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 685 Score = 25.8 bits (54), Expect = 7.2 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -1 Query: 103 RCQEAIHRKCGETPLQIR 50 +CQ H++C E+PL+I+ Sbjct: 153 QCQGKFHKECVESPLEIK 170 >At5g48060.1 68418.m05938 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1036 Score = 25.8 bits (54), Expect = 7.2 Identities = 14/50 (28%), Positives = 18/50 (36%) Frame = +2 Query: 41 IIYAYLEWSFSAFSMYCFLASSWEMPLRPFHAFHLALSTRPLGWAMLTSP 190 I+ Y E +Y F W RP H H+ + L WA P Sbjct: 872 ILVMYPELILPTMFLYMFFIGLWNFRSRPRHPPHMDMK---LSWAEAVGP 918 >At5g08470.1 68418.m00999 peroxisome biogenesis protein (PEX1) identical to peroxisome biogenesis protein PEX1 [Arabidopsis thaliana] gi|12006272|gb|AAG44817; contains Pfam profile PF00004: ATPase, AAA family; identical to cDNA peroxisome biogenesis protein PEX1 (PEX1) mRNA, partial cds GI:12006271 Length = 1130 Score = 25.8 bits (54), Expect = 7.2 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = -3 Query: 188 VMLTLPSPAVLWRAPSGRHGTVAKASPKTMPRSNTSKMRRNSTPNTHKLLLRIK 27 V+ T PS V+ P GT +PK R+ +K + N K LLR++ Sbjct: 160 VVSTFPSKGVVQLVP----GTEVAVAPKRRDRNLKAKKSQEKECNNVKALLRVQ 209 >At4g10370.1 68417.m01702 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 687 Score = 25.8 bits (54), Expect = 7.2 Identities = 7/18 (38%), Positives = 15/18 (83%) Frame = -1 Query: 103 RCQEAIHRKCGETPLQIR 50 +C++ H++C E+PL+I+ Sbjct: 149 QCEKKFHKECVESPLEIK 166 >At5g46660.1 68418.m05749 CHP-rich zinc finger protein, putative contains similarity to CHP-rich zinc finger protein Length = 305 Score = 25.4 bits (53), Expect = 9.5 Identities = 7/18 (38%), Positives = 15/18 (83%) Frame = -1 Query: 103 RCQEAIHRKCGETPLQIR 50 +CQ+ H++C ++PL+I+ Sbjct: 142 QCQKNFHKECVQSPLEIK 159 >At4g02180.1 68417.m00290 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 989 Score = 25.4 bits (53), Expect = 9.5 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 4/34 (11%) Frame = -1 Query: 106 RRCQEAIHRKCGETPLQI----RINYYLELNKFP 17 + C IH+KCGE+ I ++ LELN++P Sbjct: 380 KSCDIFIHKKCGESSGIIDHSSHPDHTLELNRYP 413 >At3g20660.1 68416.m02615 organic cation transporter family protein similar to organic cation transporter OCT3 [Rattus norvegicus] GI:3273722, organic cation transporter 3 [Mus musculus] GI:4454795; contains Pfam profile PF00083: major facilitator superfamily protein Length = 534 Score = 25.4 bits (53), Expect = 9.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 54 IWSGVSPHFRCIASWHRLGRCLCDRSMPSTW 146 I++ P +RC+ S R+G C+ PS+W Sbjct: 71 IFADQEPEWRCVGSDCRVGSLNCELD-PSSW 100 >At3g10360.1 68416.m01242 pumilio/Puf RNA-binding domain-containing protein similar to RNA binding protein PufA GB:AAD39751 [Dictyostelium discoideum] and similar to Pumilio protein GB:A46221 [Drosophila sp.] Length = 1003 Score = 25.4 bits (53), Expect = 9.5 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -3 Query: 134 HGTVAKASPKTMPRSN-TSKMRRNSTPNTH 48 H T AK SP TM S +S + RN TP++H Sbjct: 281 HST-AKNSPNTMLGSTMSSPVPRNRTPDSH 309 >At2g25570.1 68415.m03062 expressed protein Length = 288 Score = 25.4 bits (53), Expect = 9.5 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = +1 Query: 91 LLGIVL--GDAFATVPCLPLGALHKTAGLGNVN--ITYGSLLVQGVQ 219 LLGIV GD + H+ + G+ I YGSLL++GVQ Sbjct: 168 LLGIVYLTGDCVKQDVDSAIWCFHRASEKGHAGAAIAYGSLLLRGVQ 214 >At2g23180.1 68415.m02769 cytochrome P450, putative Length = 516 Score = 25.4 bits (53), Expect = 9.5 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +1 Query: 22 IYLILSNNLCVF--GVEFLRIFDVLLLGIVLGDA 117 I+ I+S+N + G EF +IFDVL GI D+ Sbjct: 89 IHHIMSSNFANYPKGTEFKKIFDVLGDGIFNADS 122 >At1g55380.1 68414.m06334 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/34 (35%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -1 Query: 172 PAQRSCGE-RQVEGMERSQRHLPRRCQEAIHRKC 74 P SCG RQ + Q + C A+H KC Sbjct: 273 PGDFSCGVCRQTVDVNYGQYSCDKECHYAVHSKC 306 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,268,723 Number of Sequences: 28952 Number of extensions: 180643 Number of successful extensions: 653 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 389454624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -