BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12e08r (315 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0930 - 9173245-9173305,9173438-9173504,9173856-9174042 59 8e-10 04_04_1383 - 33144047-33144603,33145554-33147129 29 1.0 02_04_0349 + 22222091-22222639,22222718-22223695 27 4.1 04_04_1092 + 30817641-30818171 26 5.4 03_06_0635 + 35210755-35210855,35210938-35211088,35211171-352113... 26 5.4 04_01_0024 + 344621-344830,344926-345705 26 7.1 03_05_0822 - 27963849-27964544,27965043-27965091,27965372-279654... 26 7.1 >08_01_0930 - 9173245-9173305,9173438-9173504,9173856-9174042 Length = 104 Score = 58.8 bits (136), Expect = 8e-10 Identities = 22/48 (45%), Positives = 35/48 (72%) Frame = -3 Query: 220 WRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRVTPWANGR 77 WR AG+TYI YSN+ A ++RR LK+ ++EA R++ H ++ WA+G+ Sbjct: 11 WRAAGMTYIGYSNVCAALVRRCLKEPHKSEAASREKVHFAISKWADGK 58 >04_04_1383 - 33144047-33144603,33145554-33147129 Length = 710 Score = 28.7 bits (61), Expect = 1.0 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = -3 Query: 265 FLRIKVNKNNNKMSAWRQAGLTYIN--YSNIAAKV 167 FLR+ N N + AW Q+ L +N Y+N + V Sbjct: 216 FLRLDANHFNGSLPAWNQSSLKLLNVSYNNFSGPV 250 >02_04_0349 + 22222091-22222639,22222718-22223695 Length = 508 Score = 26.6 bits (56), Expect = 4.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +1 Query: 46 TLEQLSGGVQVVRWP 90 TLE LSGGV ++ WP Sbjct: 406 TLESLSGGVPMLSWP 420 >04_04_1092 + 30817641-30818171 Length = 176 Score = 26.2 bits (55), Expect = 5.4 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +1 Query: 154 VTCEAPWLRCLSSLCKLNQLASKRSFCYCS 243 + CE P + + N+ + +FCYCS Sbjct: 128 IPCEVPAFEAILKAVEKNKKDNAAAFCYCS 157 >03_06_0635 + 35210755-35210855,35210938-35211088,35211171-35211341, 35211864-35212043,35213174-35213303,35213580-35213749 Length = 300 Score = 26.2 bits (55), Expect = 5.4 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +1 Query: 136 LEILALVTCEAPWLRCLSSLCKLNQLASKRS--FCYCSCLLLFSKI 267 L+I L+ EA WL + L K+N S R C SC + + + Sbjct: 128 LDIPKLLHNEAAWLLAVKELQKINSFKSPREKLSCIMSCCQVINNL 173 >04_01_0024 + 344621-344830,344926-345705 Length = 329 Score = 25.8 bits (54), Expect = 7.1 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -3 Query: 181 IAAKVLRRSLKQEFRAEALKRDESHVRV-TPW 89 + V RR +KQE RAEA K + V PW Sbjct: 273 VTVLVERRMVKQEHRAEAYKLYQKRTSVWIPW 304 >03_05_0822 - 27963849-27964544,27965043-27965091,27965372-27965480, 27965979-27966006,27966086-27966276,27966418-27966532, 27966955-27967206 Length = 479 Score = 25.8 bits (54), Expect = 7.1 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = -2 Query: 260 ENKSKQEQ*QNERLEASWFNLHKLLKHRSQGASQVTKARISSRGVET 120 + K +Q+Q + E + A K K RS+GA + KA+ S+G +T Sbjct: 391 KRKQQQQQGEEESVRA------KKPKERSEGAKKSNKAKKGSKGRDT 431 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,513,641 Number of Sequences: 37544 Number of extensions: 146007 Number of successful extensions: 407 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 407 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 386885760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -