BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12e07r (679 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1565.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 1.9 SPAC23H4.14 |vam6|vps39|guanyl-nucleotide exchange factor Vma6|S... 26 4.4 >SPAC1565.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 166 Score = 27.5 bits (58), Expect = 1.9 Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = -1 Query: 598 YINRANNFRK--NFLTWPVADWKELVQYLPELKVFLAEEQ*NLMTDPCGLMYTKLSLQSP 425 ++NR + NF + + KEL+ + P+++VFL P YT + + P Sbjct: 101 FVNRHTGSKPQPNFYSSSESSEKELIWFQPKMRVFLQSLSNMSYLSPSKFRYTTVYSKQP 160 Query: 424 N 422 N Sbjct: 161 N 161 >SPAC23H4.14 |vam6|vps39|guanyl-nucleotide exchange factor Vma6|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 26.2 bits (55), Expect = 4.4 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 405 RTCIFRFGDWRESFVYIKPQGSVIRFHCSSAKKTFNS 515 +TC+F +S + I P GSV+ + C AKK +S Sbjct: 863 KTCLFCHKRLGKSVISIFPDGSVVHYGC--AKKYVSS 897 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,618,193 Number of Sequences: 5004 Number of extensions: 53840 Number of successful extensions: 165 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 165 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -