BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12e07r (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42782| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_8339| Best HMM Match : rve (HMM E-Value=5.4e-31) 31 0.65 SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) 30 2.0 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) 30 2.0 SB_30312| Best HMM Match : rve (HMM E-Value=5.6e-15) 29 4.6 SB_28907| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 29 4.6 SB_55004| Best HMM Match : rve (HMM E-Value=8.7e-30) 29 4.6 SB_51753| Best HMM Match : rve (HMM E-Value=8.7e-30) 29 4.6 SB_46176| Best HMM Match : rve (HMM E-Value=8.7e-30) 29 4.6 SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_26989| Best HMM Match : Chromo (HMM E-Value=5.5e-10) 29 4.6 SB_16606| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 29 4.6 SB_40699| Best HMM Match : HSA (HMM E-Value=3.4) 28 6.0 SB_31112| Best HMM Match : Dynein_heavy (HMM E-Value=0) 28 6.0 SB_22797| Best HMM Match : WHEP-TRS (HMM E-Value=3.6) 28 6.0 SB_11605| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52467| Best HMM Match : UCH (HMM E-Value=2.6e-23) 28 8.0 SB_17172| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_42782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 45.2 bits (102), Expect = 5e-05 Identities = 28/69 (40%), Positives = 37/69 (53%) Frame = -3 Query: 557 MASSRLERIGTIFTRVEGLLSRGAMKPDDRPLWFDVYKAFPPITEPKYARPNLVVKEIRP 378 M SR R GT+ +RV LL GA+ +P+W++V +AFPPI E K R + Sbjct: 1 MTGSRHLR-GTVLSRVRNLLRSGALTR--KPVWYEVVEAFPPIVETKINR-RAESGRVAK 56 Query: 377 ILYKEDVLR 351 I Y ED R Sbjct: 57 IEYPEDFFR 65 >SB_8339| Best HMM Match : rve (HMM E-Value=5.4e-31) Length = 351 Score = 31.5 bits (68), Expect = 0.65 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = -3 Query: 407 PNLVVKEIRPILYKEDVLRAKFHSNGYGLAPVSLLNQSNETQTKRLVQQYDE 252 P++VV + P L E+ L A F NG PV+ L+ S+ Q +R VQ E Sbjct: 91 PDVVVSDNGPNLISEE-LSAFFSKNGIQHIPVAPLHPSSNGQAERTVQTVKE 141 >SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) Length = 732 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = -3 Query: 407 PNLVVKEIRPILYKEDVLRAKFHSNGYGLAPVSLLNQSNETQTKRLVQQYDE 252 P++VV + P L E+ L F NG PV+ L+ S+ Q +R VQ E Sbjct: 646 PDVVVSDNGPNLISEE-LSTFFSKNGIQHIPVAPLHPSSNGQAERTVQTVKE 696 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = -3 Query: 407 PNLVVKEIRPILYKEDVLRAKFHSNGYGLAPVSLLNQSNETQTKRLVQQYDE 252 P++VV + P L E+ L F NG PV+ L+ S+ Q +R VQ E Sbjct: 1569 PDVVVSDNGPNLISEE-LSTFFSKNGIQHIPVAPLHPSSNGQAERTVQTVKE 1619 >SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) Length = 1544 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = -3 Query: 407 PNLVVKEIRPILYKEDVLRAKFHSNGYGLAPVSLLNQSNETQTKRLVQQYDE 252 P++VV + P L E+ L F NG PV+ L+ S+ Q +R VQ E Sbjct: 1037 PDVVVSDNGPNLISEE-LSTFFSKNGIQHIPVAPLHPSSNGQAERTVQTVKE 1087 >SB_30312| Best HMM Match : rve (HMM E-Value=5.6e-15) Length = 385 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = -3 Query: 407 PNLVVKEIRPILYKEDVLRAKFHSNGYGLAPVSLLNQSNETQTKRLVQQYDE 252 P++VV + P L E+ L F NG PV+ ++ S+ Q +R VQ E Sbjct: 131 PDVVVSDNGPNLISEE-LSTFFSKNGIQHIPVAPVHPSSNGQAERTVQTVKE 181 >SB_28907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 726 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/54 (29%), Positives = 31/54 (57%) Frame = -1 Query: 661 IPSLDLIKKSKKRLFVCISETYINRANNFRKNFLTWPVADWKELVQYLPELKVF 500 + S+ ++KK +++ +CI +N+A F++N PV D +L+ L K+F Sbjct: 460 VSSMVVVKKPNEKIRLCIDPKPLNKA--FKRNRYPLPVID--DLLPQLTNAKMF 509 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = -3 Query: 407 PNLVVKEIRPILYKEDVLRAKFHSNGYGLAPVSLLNQSNETQTKRLVQQYDE 252 P++VV + P L E+ L F NG PV+ ++ S+ Q +R VQ E Sbjct: 880 PDVVVSDNGPNLISEE-LSTFFSKNGIQHIPVAPVHPSSNGQAERTVQTVKE 930 >SB_55004| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 682 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = -3 Query: 407 PNLVVKEIRPILYKEDVLRAKFHSNGYGLAPVSLLNQSNETQTKRLVQQYDE 252 P++VV + P L E+ L F NG PV+ ++ S+ Q +R VQ E Sbjct: 422 PDVVVSDNGPNLISEE-LSTFFSKNGIQHIPVAPVHPSSNGQAERTVQTVKE 472 >SB_51753| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 378 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = -3 Query: 407 PNLVVKEIRPILYKEDVLRAKFHSNGYGLAPVSLLNQSNETQTKRLVQQYDE 252 P++VV + P L E+ L F NG PV+ ++ S+ Q +R VQ E Sbjct: 246 PDVVVSDNGPNLISEE-LSTFFSKNGIQHIPVAPVHPSSNGQAERTVQTVKE 296 >SB_46176| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 378 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = -3 Query: 407 PNLVVKEIRPILYKEDVLRAKFHSNGYGLAPVSLLNQSNETQTKRLVQQYDE 252 P++VV + P L E+ L F NG PV+ ++ S+ Q +R VQ E Sbjct: 246 PDVVVSDNGPNLISEE-LSTFFSKNGIQHIPVAPVHPSSNGQAERTVQTVKE 296 >SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1089 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = -3 Query: 407 PNLVVKEIRPILYKEDVLRAKFHSNGYGLAPVSLLNQSNETQTKRLVQQYDE 252 P++VV + P L E+ L F NG PV+ ++ S+ Q +R VQ E Sbjct: 840 PDVVVSDNGPNLISEE-LSTFFSKNGIQHIPVAPVHPSSNGQAERTVQTVKE 890 >SB_26989| Best HMM Match : Chromo (HMM E-Value=5.5e-10) Length = 517 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/67 (23%), Positives = 32/67 (47%) Frame = -3 Query: 296 SNETQTKRLVQQYDELKAEGIPEDEIIEKAAQAVAVERHSYAAQKLNVTPKNPDSVTAQV 117 S E +T + V + + EDE++ K+ + +ER+ + K+ D ++Q+ Sbjct: 183 SKEARTSQTVSTSNSVNPN--TEDELVVKSIEQTGIERNDDSVGKMASNEATKDPKSSQI 240 Query: 116 LAEADIK 96 LA + K Sbjct: 241 LAASSDK 247 >SB_16606| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) Length = 313 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 598 YINRANNFRKNFLTWPVADWKELVQYLP 515 YI R +FR+ F W + W+ V LP Sbjct: 220 YIFRMKDFRQTFFRWLIKCWRRSVPVLP 247 >SB_40699| Best HMM Match : HSA (HMM E-Value=3.4) Length = 221 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = -3 Query: 422 PKYARPNLVVKEIRPILYKEDVLRAKFHSNGYGLAPVSLLNQSNETQTKRLVQQYDE 252 P+ AR L + + L ++RA + PV L+N+S + K L Q+Y E Sbjct: 122 PRSARAKLQSRSLEGFLIDGTLVRAVM-MRIFSTVPVKLVNESTTIKGKALSQEYKE 177 >SB_31112| Best HMM Match : Dynein_heavy (HMM E-Value=0) Length = 2532 Score = 28.3 bits (60), Expect = 6.0 Identities = 24/80 (30%), Positives = 36/80 (45%) Frame = -3 Query: 398 VVKEIRPILYKEDVLRAKFHSNGYGLAPVSLLNQSNETQTKRLVQQYDELKAEGIPEDEI 219 V +EI+P K L FH + L + ++ E + +RL +QYD+ E E Sbjct: 1327 VAREIKPKREKVARLERNFHLSKRELEKIEKELKALEEELERLGKQYDDAMREKSSLQE- 1385 Query: 218 IEKAAQAVAVERHSYAAQKL 159 +A +ER AA KL Sbjct: 1386 -----EAEIMERRLIAADKL 1400 >SB_22797| Best HMM Match : WHEP-TRS (HMM E-Value=3.6) Length = 117 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -3 Query: 299 QSNETQTKRLVQQYD---ELKAEGIPEDEIIEKAAQAVAVERHSYAAQ 165 + NE + +R VQ+Y +LK + E+EI+ Q + +HS A+ Sbjct: 13 KENEAKRRRAVQKYQTELKLKDQKSKEEEILAAELQQLKARKHSLEAK 60 >SB_11605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 794 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -3 Query: 563 LNMASSRLERIGTIF-TRVEGLLSRGAMKPDDRPLWFDVYKAFPPITEPKYARP 405 L ++ RL GT + T ++ ++ RG + PD + YKA PP ARP Sbjct: 738 LGYSNERLSDPGTFYPTLLKNIVIRGILPPDYPITERETYKAQPPNPPEIPARP 791 >SB_52467| Best HMM Match : UCH (HMM E-Value=2.6e-23) Length = 422 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -3 Query: 260 YDELKAEGIPEDEIIEKAAQAVAVERHSYAAQKLNVTPKNPDSVTAQVLAE 108 YD+ I E++I+ KAA + +R L + K DS T + ++E Sbjct: 352 YDDSSVSQINEEQIVSKAAYVLFYKRRCPHGNGLKESEKGVDSGTDERMSE 402 >SB_17172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 345 Score = 27.9 bits (59), Expect = 8.0 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -3 Query: 545 RLERIGTIF-TRVEGLLSRGAMKPDDRPLWFDVYKAFPPITEPKYARP 405 RL GT + T +E ++ RG + PD + YKA PP ARP Sbjct: 174 RLSDPGTFYPTLLENIVIRGILPPDYPITERETYKAKPPNPPKIPARP 221 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,374,038 Number of Sequences: 59808 Number of extensions: 363368 Number of successful extensions: 963 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 962 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -