BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12e07f (594 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 1.5 AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 23 1.9 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 23 1.9 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 23 1.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 3.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 3.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 3.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 3.4 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 22 3.4 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 22 3.4 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 7.8 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 7.8 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 7.8 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.8 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 23.4 bits (48), Expect = 1.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 108 KKFLNMASSRLERIGTIFTRVEGLLSRG 191 +KF +MAS+R R IF+ + L RG Sbjct: 175 QKFKDMASTRYARQTFIFSAIPFLRDRG 202 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 23.0 bits (47), Expect = 1.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 7 DLIKIPSLDLIKKSKKRLFVCISETYINRANN 102 DL+ PS L K + LF C+ E +I N+ Sbjct: 135 DLVTRPSYRLRKFFDELLFKCMKEKWIPLCNS 166 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.0 bits (47), Expect = 1.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 7 DLIKIPSLDLIKKSKKRLFVCISETYINRANN 102 DL+ PS L K + LF C+ E +I N+ Sbjct: 368 DLVTRPSYRLRKFFDELLFKCMKEKWIPLCNS 399 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.0 bits (47), Expect = 1.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 7 DLIKIPSLDLIKKSKKRLFVCISETYINRANN 102 DL+ PS L K + LF C+ E +I N+ Sbjct: 368 DLVTRPSYRLRKFFDELLFKCMKEKWIPLCNS 399 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.4 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = -3 Query: 286 TTRLGRAYLGSVIGGKALYTSNHKGLSSGFIAPRLRRPSTLVNIVPIL 143 T L R Y YT +G + + R PST+ NI+ +L Sbjct: 845 TLLLQRGYRVEYSAASDAYTHAPEGFNEFYNQRRRWVPSTIANIMDLL 892 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.4 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = -3 Query: 286 TTRLGRAYLGSVIGGKALYTSNHKGLSSGFIAPRLRRPSTLVNIVPIL 143 T L R Y YT +G + + R PST+ NI+ +L Sbjct: 845 TLLLQRGYRVEYSAASDAYTHAPEGFNEFYNQRRRWVPSTIANIMDLL 892 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.4 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = -3 Query: 286 TTRLGRAYLGSVIGGKALYTSNHKGLSSGFIAPRLRRPSTLVNIVPIL 143 T L R Y YT +G + + R PST+ NI+ +L Sbjct: 845 TLLLQRGYRVEYSAASDAYTHAPEGFNEFYNQRRRWVPSTIANIMDLL 892 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.4 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = -3 Query: 286 TTRLGRAYLGSVIGGKALYTSNHKGLSSGFIAPRLRRPSTLVNIVPIL 143 T L R Y YT +G + + R PST+ NI+ +L Sbjct: 845 TLLLQRGYRVEYSAASDAYTHAPEGFNEFYNQRRRWVPSTIANIMDLL 892 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 125 HVKKFFLKLLARLIYVSLMQTNNLFLDFFIKSKL 24 HV F+K RL Y L++ + L + F + S L Sbjct: 125 HVDVSFIKAGFRLEYKQLLKRSYLIISFVLFSLL 158 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 125 HVKKFFLKLLARLIYVSLMQTNNLFLDFFIKSKL 24 HV F+K RL Y L++ + L + F + S L Sbjct: 125 HVDVSFIKAGFRLEYKQLLKRSYLIISFVLFSLL 158 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.0 bits (42), Expect = 7.8 Identities = 6/18 (33%), Positives = 10/18 (55%) Frame = -2 Query: 299 SYFFDYKIRTCIFRFGDW 246 S+ +DY + T + DW Sbjct: 271 SHLYDYDLTTHVMLLSDW 288 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.0 bits (42), Expect = 7.8 Identities = 6/18 (33%), Positives = 10/18 (55%) Frame = -2 Query: 299 SYFFDYKIRTCIFRFGDW 246 S+ +DY + T + DW Sbjct: 271 SHLYDYDLTTHVMLLSDW 288 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 7.8 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = -3 Query: 286 TTRLGRAYLGSVIGGKALYTSNHKGLSSGFIAPRLRRPSTLVNIVPIL 143 T L R Y +T +G + + R PST+ NI+ +L Sbjct: 585 TLLLQRGYRVEYSAASDAFTHCPEGFNEFYNQRRRWMPSTMANILDLL 632 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 7.8 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = -3 Query: 286 TTRLGRAYLGSVIGGKALYTSNHKGLSSGFIAPRLRRPSTLVNIVPIL 143 T L R Y +T +G + + R PST+ NI+ +L Sbjct: 818 TLLLQRGYRVEYSAASDAFTHCPEGFNEFYNQRRRWMPSTMANILDLL 865 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 7.8 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = -3 Query: 286 TTRLGRAYLGSVIGGKALYTSNHKGLSSGFIAPRLRRPSTLVNIVPIL 143 T L R Y +T +G + + R PST+ NI+ +L Sbjct: 818 TLLLQRGYRVEYSAASDAFTHCPEGFNEFYNQRRRWMPSTMANILDLL 865 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,156 Number of Sequences: 336 Number of extensions: 2588 Number of successful extensions: 17 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -