BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12e07f (594 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0367 - 16840732-16843428,16844425-16844760 31 0.69 02_02_0667 + 12765759-12765787,12766644-12766732,12766967-127670... 30 1.2 12_01_1059 - 10934937-10935446,10938224-10938271,10938383-109386... 29 2.1 07_01_0355 + 2597592-2598280,2599150-2599426 29 2.8 04_04_0190 - 23442824-23442846,23442891-23442949,23443613-234437... 29 2.8 08_01_1032 + 10447474-10448030,10448784-10449813 28 4.9 01_01_0863 - 6724200-6724414,6726300-6726576,6726976-6727145,672... 28 4.9 03_05_0743 - 27317823-27317969,27318027-27319997,27320335-27321435 28 6.5 06_01_0944 + 7264833-7265120,7265511-7265600,7265702-7265798,726... 27 8.5 03_02_0419 - 8296314-8296448,8296546-8296711,8296799-8296902,829... 27 8.5 01_05_0786 + 25207519-25207651,25207766-25207862,25208290-25208413 27 8.5 >11_04_0367 - 16840732-16843428,16844425-16844760 Length = 1010 Score = 31.1 bits (67), Expect = 0.69 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 7/80 (8%) Frame = +3 Query: 327 RAKFHSNGYGLAPVSLLNQSNETQTK--RLVQQYDELKAE----GIPEDEIIEKAAQAV- 485 R + NG L+ V L+ SNE TK L+Q++DE+K I +++ + + A + Sbjct: 108 RKRHQVNGEHLSEVGLVPVSNELATKARELIQRFDEMKVYYKYFSISDNDGVRRTAPGIE 167 Query: 486 AVERHSYAAQKLNVTPKNPD 545 V SY K ++ + D Sbjct: 168 CVRPTSYFVVKESIVGRESD 187 >02_02_0667 + 12765759-12765787,12766644-12766732,12766967-12767065, 12769131-12769304,12769376-12769590,12769746-12769835, 12770744-12770905 Length = 285 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 164 GKYCTNSFQSATGHVKKFFLKLLARLIYV 78 G C +F S G+ +KFFLK+ A YV Sbjct: 71 GTVCNLNFSSLLGYREKFFLKIYAAAFYV 99 >12_01_1059 - 10934937-10935446,10938224-10938271,10938383-10938619, 10938711-10938747,10941018-10941286 Length = 366 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +3 Query: 129 SSRLERIGTIFTRVEGLLSRGAMKPDDRPLWFDVYKAFPPITEPKYARPNLVV 287 +SRL R+ + L M P R WFD+YK I P+ P L++ Sbjct: 146 ASRLHRLRAVVLHSPILSGLRVMYPVKRTYWFDIYKNIDKI--PQVTCPVLII 196 >07_01_0355 + 2597592-2598280,2599150-2599426 Length = 321 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 202 GFIAPRLRRPSTLVNIV 152 GFIA RLRRPSTL+ ++ Sbjct: 3 GFIAGRLRRPSTLLTVL 19 >04_04_0190 - 23442824-23442846,23442891-23442949,23443613-23443737, 23443767-23443901,23444195-23444301,23444488-23444566, 23444856-23444942,23445045-23445281,23445783-23446128, 23446486-23446694 Length = 468 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = -2 Query: 215 GSVIRFHCSSAKKTFNSGKYCTNSFQSATGHVKKFFLKLLARLIYVS 75 GS + HCS + F S +CT + S + F L+ RL S Sbjct: 61 GSFLEDHCSRYGRVFKSHLFCTPTIVSCDQELNHFILQNEERLFQCS 107 >08_01_1032 + 10447474-10448030,10448784-10449813 Length = 528 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +3 Query: 402 KRLVQQYDELKAEGIPEDEIIEKAAQA--VAVERHSYAAQKLNVTPK 536 +R ++ YDE+K G D +EK + +A H A K N+ P+ Sbjct: 470 QRALEYYDEMKENGFASDPKLEKEFRTFLLANRDHWRGAGKYNIIPQ 516 >01_01_0863 - 6724200-6724414,6726300-6726576,6726976-6727145, 6727250-6727526 Length = 312 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 Query: 123 MASSRLERIGTIFTRVEGLLSRGAMKPDDRPLWFDVYKAFPPITEPKY 266 +AS + R IF+ + L G + P+ FD Y F P+T P Y Sbjct: 28 VASLSVRRYDAIFSFGDSLADTG-----NNPVVFDWYSIFDPVTRPPY 70 >03_05_0743 - 27317823-27317969,27318027-27319997,27320335-27321435 Length = 1072 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 109 KNFLTWPVADWKELVQYLPELKVFLAEEQ*NLMTDPCGLMYTKLSLQS 252 + L W DW E VQ +P L+ E L P GL+Y +L++ Sbjct: 899 QGMLRWASWDWDEHVQAMPALESLTVENS-KLNRLPPGLVYHTRALKA 945 >06_01_0944 + 7264833-7265120,7265511-7265600,7265702-7265798, 7265927-7265988,7266508-7266596,7266702-7266822, 7266915-7267058,7267492-7267820,7268154-7268394, 7269042-7269245,7271150-7271619,7272703-7272746, 7273121-7273211,7273494-7273596,7273682-7273783, 7274214-7274300,7274421-7274531 Length = 890 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 261 KYARPNLVVKEIRPILYKEDVLRAKFHSNGYGLAPV 368 K A+P+L VK+I PIL K V+ N P+ Sbjct: 257 KEAKPSLYVKKILPILLKNRVVHLVGFGNRLSFDPI 292 >03_02_0419 - 8296314-8296448,8296546-8296711,8296799-8296902, 8297000-8297176 Length = 193 Score = 27.5 bits (58), Expect = 8.5 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Frame = +3 Query: 258 PKYARPNLVVKEIRPILYKEDVLRAKFHSNGYGLAPVSLLN--QSNETQTKRLVQQYDEL 431 P AR ++ ++R +L + + RA H +A ++L + E KRL++ +L Sbjct: 32 PHLARKSIATDDVRQLLTLDHLDRA-IHRAEQVIAEDNMLEAFEMIEMYCKRLIEHAAKL 90 Query: 432 KAEGIPEDEIIEKAAQAV 485 G DEI E AA + Sbjct: 91 DKPGECTDEIREAAASVM 108 >01_05_0786 + 25207519-25207651,25207766-25207862,25208290-25208413 Length = 117 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 243 PPITEPKYARPNLVVKEIRPILYKEDVL 326 PP T P YA L E+R YK+D+L Sbjct: 16 PPSTFPSYACKILSFDELRARAYKKDIL 43 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,139,634 Number of Sequences: 37544 Number of extensions: 245655 Number of successful extensions: 673 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 672 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -