BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12e02f (608 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 1.8 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 2.3 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 2.3 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.4 bits (48), Expect = 1.8 Identities = 11/38 (28%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +1 Query: 163 AACKGCKQKIDQGSLRIAVMVQSAFFDGKQPN--WHHE 270 A C K ++G++R A+ + DGK W+H+ Sbjct: 152 ALCNHIKYSTNKGNIRSAITIFPQRTDGKHDYRVWNHQ 189 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +1 Query: 223 VQSAFFDGKQPNWHHEDCFFKKRRLNSFTEIANFN 327 + F+ QP +H + + K R N + N+N Sbjct: 38 IYELFWHVDQPTVYHPELYQKARTFNLVENLDNYN 72 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +1 Query: 223 VQSAFFDGKQPNWHHEDCFFKKRRLNSFTEIANFN 327 + F+ QP +H + + K R N + N+N Sbjct: 38 IYELFWHVDQPTVYHPELYQKARTFNLVENLDNYN 72 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,856 Number of Sequences: 438 Number of extensions: 2977 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -