BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12e01r (751 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 33 0.20 At1g73500.1 68414.m08509 mitogen-activated protein kinase kinase... 32 0.35 At1g76950.1 68414.m08958 zinc finger protein (PRAF1) / regulator... 31 0.62 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 29 3.3 At3g56880.1 68416.m06327 VQ motif-containing protein contains PF... 29 3.3 At4g13800.1 68417.m02139 permease-related contains 9 predicted t... 28 5.8 At4g37690.1 68417.m05332 galactosyl transferase GMA12/MNN10 fami... 28 7.6 At3g28780.1 68416.m03592 glycine-rich protein similar to H41 gen... 28 7.6 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 81 P*ADPNDVIPIS*RLPPLPMVRGPPESPLQVLRPLEPS 194 P PN +IP LPP+P++ PP P L P P+ Sbjct: 284 PTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPT 321 >At1g73500.1 68414.m08509 mitogen-activated protein kinase kinase (MAPKK), putative (MKK9) mitogen-activated protein kinase kinase (MAPKK) family, PMID:12119167 Length = 310 Score = 32.3 bits (70), Expect = 0.35 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = -1 Query: 289 QQKRQVSLQVITNAVCARTFGNNVIIASTLCVDGSNGRSTCSGDSGGPLTIGSGG 125 +++RQ++L++ + R F + A+T V G NG S C + L G+GG Sbjct: 5 RERRQLNLRLPLPPISDRRFSTSSSSATTTTVAGCNGISACDLEKLNVLGCGNGG 59 >At1g76950.1 68414.m08958 zinc finger protein (PRAF1) / regulator of chromosome condensation (RCC1) family protein identical to zinc finger protein PRAF1 [Arabidopsis thaliana] gi|15811367|gb|AAL08940. Length = 1103 Score = 31.5 bits (68), Expect = 0.62 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = -1 Query: 205 TLCVDGSNGRSTCSGDSGGPLTIGSGGSRQLIGITSFGSAQGCQRGH 65 TL G GRS G SGG L++ + SR+L + S+ RGH Sbjct: 121 TLISTGQGGRSKIDGWSGGGLSVDA--SRELTSSSPSSSSASASRGH 165 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -2 Query: 333 PASEGPPMLLREPTTNKNAK*ASRSLP-TPSAPARLETM*SLPPP 202 P PP PT N A +S P P AP RL T + PPP Sbjct: 728 PPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPP 772 >At3g56880.1 68416.m06327 VQ motif-containing protein contains PF05678: VQ motif Length = 245 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -3 Query: 677 PPSCWTCDRTDEWQNFHLRSFLTDQHPLRDRRSLLEDQESPGSSVHPRS 531 PPSC DR+ SFL++ H + +++ D +P S H +S Sbjct: 168 PPSCGNLDRSSAVPTLDTSSFLSNHH----QENIITDLGAPTGSFHHQS 212 >At4g13800.1 68417.m02139 permease-related contains 9 predicted transmembrane domains; contains Pfam PF05653: Protein of unknown function (DUF803); identified as COG0697, Permeases of the drug/metabolite transporter (DMT) superfamily Length = 336 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 656 HKSSKMGVSTSVGGRTTHNP 715 HK+ MG STS+ G T+H+P Sbjct: 294 HKTKDMGNSTSLRGSTSHSP 313 >At4g37690.1 68417.m05332 galactosyl transferase GMA12/MNN10 family protein low similarity to alpha-1,2-galactosyltransferase, Schizosaccharomyces pombe [SP|Q09174] Length = 432 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -1 Query: 136 GSGGSRQLIGITSFGSAQGCQRGHPAGFARVTSFNSWIRA 17 G GSR+ IT F Q C H + T +N IRA Sbjct: 356 GGRGSRRRAFITHFTGCQPCSGDHNPSYDGDTCWNEMIRA 395 >At3g28780.1 68416.m03592 glycine-rich protein similar to H41 gene for histone protein GB:X15142 GI:3204 [Physarum polycephalum] Length = 614 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/66 (25%), Positives = 26/66 (39%) Frame = -1 Query: 319 TSDAASGANNQQKRQVSLQVITNAVCARTFGNNVIIASTLCVDGSNGRSTCSGDSGGPLT 140 +++A SG + + V + G + T S G +T G SGG T Sbjct: 478 STEAGSGTSTETSSMGGGSAAAGGVSESSSGGSTAAGGT-SESASGGSATAGGASGGTYT 536 Query: 139 IGSGGS 122 +GGS Sbjct: 537 DSTGGS 542 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,475,823 Number of Sequences: 28952 Number of extensions: 296990 Number of successful extensions: 1290 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1290 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -