BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d24f (597 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 27 0.091 DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 23 2.0 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 7.9 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 27.5 bits (58), Expect = 0.091 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = -3 Query: 211 PRSYRGSTRRLRHFYSNVVKLYFKSD---IHLARL 116 P+SY G+T L+ FY V K+ +S IHL+ L Sbjct: 57 PKSYFGTTTNLKRFYKVVEKILTQSSFECIHLSVL 91 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 211 PRSYRGSTRRLRHFY 167 P+SY G+T L+ FY Sbjct: 57 PKSYFGTTTNLKRFY 71 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 70 VGRLTCNASNSTDTLSLT 17 VG TC ASNS + T Sbjct: 673 VGNYTCLASNSASVTTYT 690 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,795 Number of Sequences: 336 Number of extensions: 2478 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -