BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d23r (730 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 24 1.7 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 21 9.0 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.8 bits (49), Expect = 1.7 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = -2 Query: 453 EGASNVVVNDVTFNILRSKFSVDLTLPKLSASSV-AVNGEATIFGRELAVASSGSLVVED 277 EG S +V++ TFN L S T K S+SSV ATI EL L ++D Sbjct: 310 EGVSCLVIDRETFNQLISSLDEIRTRYKDSSSSVEGWENRATI--PELN-EEFRDLRLQD 366 Query: 276 LRLVSTVSI 250 LR ++T+ + Sbjct: 367 LRPLATLGV 375 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 1 NFNHTH*GGCLQNIVDDEEDDAL 69 NFN + +Q ++DD E D L Sbjct: 78 NFNEKNTRDIVQAVLDDNETDQL 100 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,200 Number of Sequences: 438 Number of extensions: 3334 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -