BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d21r (720 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07741.1 68415.m00991 ATPase subunit 6, putative similar to A... 46 2e-05 >At2g07741.1 68415.m00991 ATPase subunit 6, putative similar to ATPase subunit 6 GI:515963 from [Raphanus sativus]; contains Pfam profile: PF00119 ATP synthase, A subunit Length = 385 Score = 46.4 bits (105), Expect = 2e-05 Identities = 39/132 (29%), Positives = 52/132 (39%), Gaps = 7/132 (5%) Frame = -1 Query: 387 PYIFTRTRHXXXXXXXXXXXXXXXXLYG*IKNTNHIFIHIIPQGTPYILIPFXXXXXXXX 208 PY FT T H + G ++ H F ++P G P L PF Sbjct: 241 PYSFTVTSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELIS 300 Query: 207 XXIRPGTLAVRLTANIIAGHLLITLLRRTG-----TNISFY--XXXXXXXXXXXXXXLES 49 R +L +RL AN++AGH L+ +L N FY LE Sbjct: 301 YCFRALSLGIRLFANMMAGHSLVKILSGFAWTMLCMNDIFYFIGALGPLFIVLALTGLEL 360 Query: 48 AVAIIQSYVITI 13 VAI+Q+YV TI Sbjct: 361 GVAILQAYVFTI 372 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,471,893 Number of Sequences: 28952 Number of extensions: 116103 Number of successful extensions: 190 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 190 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -