BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d17r (716 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1142.01 ||SPAC17G6.18|DUF654 family protein|Schizosaccharomy... 30 0.38 SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 25 8.2 >SPAC1142.01 ||SPAC17G6.18|DUF654 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 667 Score = 29.9 bits (64), Expect = 0.38 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 539 WKAMLDFCECTI----SXKEAVGRVRDVKAHRRRAWAREADLAQALXLPLIVSXPPHMSV 706 W+ + +FC+ + S A+G D+ A RRR +A D A L +S P+M Sbjct: 368 WRTVFEFCKALLQFDMSDPYAIGTCIDIYALRRREFAWIIDFANYLENSNKISDTPNMLY 427 Query: 707 S 709 S Sbjct: 428 S 428 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 25.4 bits (53), Expect = 8.2 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = -2 Query: 136 FCRQHAPPQRWQDEQTQRNPPPRATIKNPLRNLFFYLNIYVS 11 F QH PP+ + +P R NP +F L IY+S Sbjct: 1033 FYIQHPPPKSYLSWSVTFDPQRRRYYINPSGCVFVSLGIYLS 1074 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,055,002 Number of Sequences: 5004 Number of extensions: 63417 Number of successful extensions: 181 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 181 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -