BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d17r (716 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.2 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 2.9 U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 23 3.8 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 5.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.0 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 6.7 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 8.8 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -3 Query: 600 TRPTASXCEMVHSQKSSIAFHDSSSPIH 517 T T S CEM+H+ + + ++ P+H Sbjct: 566 TAATLSFCEMIHNAQVNKRSIHNNYPVH 593 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -2 Query: 532 IVAYSFPIFAKRSRRHPSHAGQTTSACSAVSKS 434 I +F + A+ +R + +H G+ C SKS Sbjct: 96 ICGKTFAVPARLTRHYRTHTGEKPYQCEYCSKS 128 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +3 Query: 624 VERGPGRRISP 656 V+RGPG R+SP Sbjct: 109 VQRGPGGRLSP 119 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.2 bits (45), Expect = 5.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 155 TWRSVNPRQCGSTAPGQRHL 214 T RSVNPR GS R L Sbjct: 385 TGRSVNPRYYGSLQAAARKL 404 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 472 GQTTSACSAVSKSQPQWWHCAIGSLRSDA 386 G T AC+AV +W+ +R+D+ Sbjct: 1329 GSATLACNAVGDPTREWYKGQGEQIRTDS 1357 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 472 GQTTSACSAVSKSQPQWWHCAIGSLRSDA 386 G T AC+AV +W+ +R+D+ Sbjct: 1325 GSATLACNAVGDPTREWYKGQGEQIRTDS 1353 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 549 IAFHDSSSPIHFLFL 505 + FH+ S P H+L+L Sbjct: 100 VTFHEMSIPNHYLWL 114 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 8.8 Identities = 6/17 (35%), Positives = 9/17 (52%) Frame = -3 Query: 228 HMGIVRWRCPGAVEPHC 178 H G+V W+ P + C Sbjct: 137 HQGLVEWKPPAIYKSSC 153 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 221,496 Number of Sequences: 438 Number of extensions: 4997 Number of successful extensions: 16 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -