BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d15r (727 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12C2.11 ||SPBC21D10.02|glutamine-fructose-6-phosphate transa... 27 3.6 SPCC1902.02 |mug72|SPCC663.16c|ketopantoate reductase |Schizosac... 26 4.8 SPAC1F7.07c |fip1||iron permease Fip1|Schizosaccharomyces pombe|... 26 6.3 SPAC3G6.01 |hrp3||ATP-dependent DNA helicase Hrp3|Schizosaccharo... 25 8.3 >SPBC12C2.11 ||SPBC21D10.02|glutamine-fructose-6-phosphate transaminase |Schizosaccharomyces pombe|chr 2|||Manual Length = 696 Score = 26.6 bits (56), Expect = 3.6 Identities = 10/33 (30%), Positives = 24/33 (72%) Frame = -1 Query: 676 EALEKIQKRPXLFDGLEKWLDKLEKTVHHCAAI 578 +++ ++++R + DGL + +K+++T+H AAI Sbjct: 511 DSVSRLERRNEIIDGLAEIGEKVQETLHLNAAI 543 >SPCC1902.02 |mug72|SPCC663.16c|ketopantoate reductase |Schizosaccharomyces pombe|chr 3|||Manual Length = 574 Score = 26.2 bits (55), Expect = 4.8 Identities = 29/94 (30%), Positives = 39/94 (41%), Gaps = 1/94 (1%) Frame = -1 Query: 667 EKIQKRPXLFDGLEKWL-DKLEKTVHHCAAIFVDNSGVDIVLGILPFVRGLLLRGTSVIL 491 E I+ R +F G KW D + TV A + + L ILP V L V+ Sbjct: 49 EGIRIRSSVF-GSTKWKPDVVAPTVEQLAMNSEPFDYIFVCLKILPSVYNLDTAIKEVVT 107 Query: 490 CANEWPALNDVTNIELEEILQHASLICPVLAAAL 389 + LN + E+ LQHA PVL+ L Sbjct: 108 PGHTCIVLNTTGIVGAEKELQHAFPNNPVLSFVL 141 >SPAC1F7.07c |fip1||iron permease Fip1|Schizosaccharomyces pombe|chr 1|||Manual Length = 397 Score = 25.8 bits (54), Expect = 6.3 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -1 Query: 628 EKWLDKLEKTVHHCAAIFVDNSGVDIVLGILPFVRGLLLRGTSVIL 491 EKW KL K++ + A + N G + +LPF +L G V++ Sbjct: 120 EKWRKKLMKSIANRKAKGISNWGKKYSMFLLPFFT-VLREGLEVVV 164 >SPAC3G6.01 |hrp3||ATP-dependent DNA helicase Hrp3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1388 Score = 25.4 bits (53), Expect = 8.3 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 670 LEKIQKRPXLFDGLEK-WLDKL 608 L+K P LFDG+E+ W+ K+ Sbjct: 651 LKKASNHPYLFDGVEESWMQKI 672 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,000,532 Number of Sequences: 5004 Number of extensions: 61894 Number of successful extensions: 142 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 341222980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -