BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d15r (727 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 24 5.5 AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory pr... 23 7.3 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 23 9.6 AF203339-1|AAF19834.1| 156|Anopheles gambiae immune-responsive ... 23 9.6 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 23.8 bits (49), Expect = 5.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 489 QSITDVPLSNKPRTNGKIPRTISTPL 566 Q +TDVP+ P T+G I + P+ Sbjct: 329 QDLTDVPIRKNPPTSGFIGLGLLLPV 354 >AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory protein protein. Length = 299 Score = 23.4 bits (48), Expect = 7.3 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 655 KRPXLFDGLEKWLDKLEKTVHHCAAIFVDNS 563 KRP FDG+ + L K+ V+ A + + +S Sbjct: 54 KRPPFFDGMTRELPKIGNIVNARALLNLGDS 84 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 23.0 bits (47), Expect = 9.6 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +2 Query: 269 KYN*VNSTHFHFSTKTYTYSSKIET 343 KY + +TH+H + +YS+ +T Sbjct: 135 KYQQIANTHYHAMLEKVSYSNPTQT 159 >AF203339-1|AAF19834.1| 156|Anopheles gambiae immune-responsive serpin-related proteinISerpF1 protein. Length = 156 Score = 23.0 bits (47), Expect = 9.6 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +2 Query: 269 KYN*VNSTHFHFSTKTYTYSSKIET 343 KY + +TH+H + +YS+ +T Sbjct: 36 KYQQIANTHYHAMLEKVSYSNPTQT 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 752,659 Number of Sequences: 2352 Number of extensions: 14922 Number of successful extensions: 21 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -