BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d15r (727 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 25 0.55 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 25 0.55 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 25 0.55 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 22 6.8 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 9.0 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 9.0 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 9.0 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 9.0 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 25.4 bits (53), Expect = 0.55 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +1 Query: 565 YYQQIWLHSDEQFSPIYPTIFLNHQTAXVFSGFFQGLHKGHSLRYL 702 +Y + W D S IFL FS FQ LH G +LR L Sbjct: 163 HYLRTWFFLDLISSIPLDYIFLIFNQFQDFSESFQILHAGRALRIL 208 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 25.4 bits (53), Expect = 0.55 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +1 Query: 565 YYQQIWLHSDEQFSPIYPTIFLNHQTAXVFSGFFQGLHKGHSLRYL 702 +Y + W D S IFL FS FQ LH G +LR L Sbjct: 163 HYLRTWFFLDLISSIPLDYIFLIFNQFQDFSESFQILHAGRALRIL 208 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 25.4 bits (53), Expect = 0.55 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +1 Query: 565 YYQQIWLHSDEQFSPIYPTIFLNHQTAXVFSGFFQGLHKGHSLRYL 702 +Y + W D S IFL FS FQ LH G +LR L Sbjct: 163 HYLRTWFFLDLISSIPLDYIFLIFNQFQDFSESFQILHAGRALRIL 208 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/24 (29%), Positives = 11/24 (45%) Frame = -3 Query: 98 ILKYCENHDYASIQCN*FMNFLQC 27 I+ C N +Y C ++QC Sbjct: 108 IVAVCRNEEYTGDDCQKTYQYVQC 131 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 687 VAFMKPLKKSRKDLGCL 637 V+ M+ +K R +LGCL Sbjct: 320 VSKMREMKMDRTELGCL 336 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 687 VAFMKPLKKSRKDLGCL 637 V+ M+ +K R +LGCL Sbjct: 320 VSKMREMKMDRTELGCL 336 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/41 (21%), Positives = 19/41 (46%) Frame = +3 Query: 267 SSIIKSTPRTFISVQRPILIVLKSRHGPL*PLDFTTKSPVD 389 S +++ PRT + + + + P+ PL F P++ Sbjct: 44 SGLVRGFPRTVLDKEVHVFYGIPFAKPPIGPLRFRKPLPIE 84 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/41 (21%), Positives = 19/41 (46%) Frame = +3 Query: 267 SSIIKSTPRTFISVQRPILIVLKSRHGPL*PLDFTTKSPVD 389 S +++ PRT + + + + P+ PL F P++ Sbjct: 44 SGLVRGFPRTVLDKEVHVFYGIPFAKPPIGPLRFRKPLPIE 84 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,222 Number of Sequences: 438 Number of extensions: 4353 Number of successful extensions: 16 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -