BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d14r (686 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1460 - 37519393-37519591,37519724-37519746,37519843-37519905 52 6e-07 10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212... 29 4.6 04_04_1693 + 35404336-35404515,35405732-35406019,35406189-354062... 29 4.6 02_05_0096 + 25785995-25786311,25786716-25786776,25787825-257880... 29 4.6 >01_06_1460 - 37519393-37519591,37519724-37519746,37519843-37519905 Length = 94 Score = 51.6 bits (118), Expect = 6e-07 Identities = 25/59 (42%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = -3 Query: 603 VQDISGGCGAMFEISVEAKEFVGLNRVKQHRLVTDSLKNEIAEMHGIRIH--TTPAATQ 433 V D SGGCGA +EI V +++F G +++HR+V +L +AE+H + I TPA Q Sbjct: 23 VTDTSGGCGASYEIEVVSEKFEGKRLLERHRMVNTALAPHMAEIHAVSIKKALTPAQAQ 81 >10_08_0553 - 18720436-18720494,18721102-18721106,18721136-18721257, 18721390-18721478,18722136-18722316,18722403-18722654, 18722755-18722993,18723680-18723914,18724072-18724132, 18724632-18724987 Length = 532 Score = 28.7 bits (61), Expect = 4.6 Identities = 24/96 (25%), Positives = 47/96 (48%), Gaps = 3/96 (3%) Frame = -2 Query: 451 DAGRHAMRILL---KREIASKFSEMTNFWKKYIKIQLLPLDKYTYTEDSL*SESQPLGAE 281 D ++A+++++ RE+A + S++ KY+ IQ++ T +D + QP+ Sbjct: 210 DPEKNAIQVVILVPTRELALQTSQVCKELGKYLNIQVMVSTGGTSLKDDIMRLYQPV--- 266 Query: 280 FFQFLIHHLQICTKVMISDETNKSMCTCRDITNLMV 173 HL + T I D T K +C +D + L++ Sbjct: 267 -------HLLVGTPGRILDLTRKGICVLKDCSMLVM 295 >04_04_1693 + 35404336-35404515,35405732-35406019,35406189-35406278, 35406487-35406564,35406638-35406718,35407300-35407350, 35407788-35407933,35408169-35408235,35408328-35408387, 35408472-35408501,35408776-35408835,35408936-35409052, 35409790-35409903,35410068-35410166,35410572-35410697, 35410774-35410848,35410958-35411029,35411167-35411277, 35411760-35411843,35413149-35413256,35414207-35414308, 35414393-35414455,35414524-35414598,35414901-35414972, 35415063-35415187,35415251-35415302,35415380-35415448, 35415525-35415540,35415941-35415989,35416607-35417180 Length = 1077 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 442 RHAMRILLKREIASKFSEMTNFWKKYIKIQLLP 344 R A +LLK + + FS M ++Y+K +LLP Sbjct: 67 RQAAGLLLKNNLRATFSSMPPASQQYVKSELLP 99 >02_05_0096 + 25785995-25786311,25786716-25786776,25787825-25788059, 25788292-25788530,25789700-25789951,25790043-25790223, 25790864-25790952,25791269-25791342,25791481-25791584, 25791919-25791957,25792324-25792436 Length = 567 Score = 28.7 bits (61), Expect = 4.6 Identities = 24/96 (25%), Positives = 48/96 (50%), Gaps = 3/96 (3%) Frame = -2 Query: 451 DAGRHAMRILL---KREIASKFSEMTNFWKKYIKIQLLPLDKYTYTEDSL*SESQPLGAE 281 D ++A+++++ RE+A + S++ K++KIQ++ T +D + QP+ Sbjct: 197 DQEKNAIQVVILVPTRELALQTSQVCKELGKHLKIQVMVTTGGTSLKDDIIRLYQPV--- 253 Query: 280 FFQFLIHHLQICTKVMISDETNKSMCTCRDITNLMV 173 HL + T I D T K +C +D + L++ Sbjct: 254 -------HLLVGTPGRILDLTKKGICILKDCSMLIM 282 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,933,016 Number of Sequences: 37544 Number of extensions: 358258 Number of successful extensions: 915 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -