BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d14f (594 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 2.6 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 22 4.5 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.6 bits (46), Expect = 2.6 Identities = 10/37 (27%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -3 Query: 511 EIGKIL--LLMVDFHFKANLQYKYTCLMAITVFLCIF 407 + GK+L L ++++FK + + Y L+ + C F Sbjct: 114 KFGKLLINLYTINYNFKESERNDYVSLLQLVFVFCYF 150 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.8 bits (44), Expect = 4.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 535 YIFANDG*EIGKILLLMVDF 476 Y F ND EI K+ +VDF Sbjct: 188 YCFRNDNSEILKMATQLVDF 207 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,288 Number of Sequences: 336 Number of extensions: 3296 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -