BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d14f (594 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1460 - 37519393-37519591,37519724-37519746,37519843-37519905 52 5e-07 04_04_1693 + 35404336-35404515,35405732-35406019,35406189-354062... 29 3.7 >01_06_1460 - 37519393-37519591,37519724-37519746,37519843-37519905 Length = 94 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/59 (42%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = +2 Query: 176 VQDISGGCGAMFEISVEAKEFVGLNRVKQHRLVTDSLKNEIAEMHGIRIH--TTPAATQ 346 V D SGGCGA +EI V +++F G +++HR+V +L +AE+H + I TPA Q Sbjct: 23 VTDTSGGCGASYEIEVVSEKFEGKRLLERHRMVNTALAPHMAEIHAVSIKKALTPAQAQ 81 >04_04_1693 + 35404336-35404515,35405732-35406019,35406189-35406278, 35406487-35406564,35406638-35406718,35407300-35407350, 35407788-35407933,35408169-35408235,35408328-35408387, 35408472-35408501,35408776-35408835,35408936-35409052, 35409790-35409903,35410068-35410166,35410572-35410697, 35410774-35410848,35410958-35411029,35411167-35411277, 35411760-35411843,35413149-35413256,35414207-35414308, 35414393-35414455,35414524-35414598,35414901-35414972, 35415063-35415187,35415251-35415302,35415380-35415448, 35415525-35415540,35415941-35415989,35416607-35417180 Length = 1077 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 337 RHAMRILLKREIASKFSEMTNFWKKYIKIQLLP 435 R A +LLK + + FS M ++Y+K +LLP Sbjct: 67 RQAAGLLLKNNLRATFSSMPPASQQYVKSELLP 99 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,065,605 Number of Sequences: 37544 Number of extensions: 298046 Number of successful extensions: 781 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -