BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d12r (684 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0945 + 9351915-9351929,9352221-9352386,9352903-9353024,935... 31 1.1 >12_01_0945 + 9351915-9351929,9352221-9352386,9352903-9353024, 9353098-9353214,9356997-9357077,9357204-9357272, 9357727-9357790,9357988-9358067,9358164-9358247, 9358418-9358502,9359658-9359743,9359924-9360045, 9360841-9360901,9360981-9361166,9363622-9363723, 9363803-9363844,9363949-9364086 Length = 539 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/61 (24%), Positives = 32/61 (52%) Frame = -3 Query: 424 SSHRMKNKTFPTENNSTCWVYQPYKVISECHPCSDFEIRSKSIGVCIHTSFKEILKCENG 245 S + ++TFP ++ S C+ V S+ + CS E R++++G C+ ++ + G Sbjct: 414 SLRSVSSQTFP-KHTSLCYSSHSILVPSDANYCSIREGRTQTVGECLRREYRMVCHVMRG 472 Query: 244 E 242 + Sbjct: 473 D 473 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,295,983 Number of Sequences: 37544 Number of extensions: 277602 Number of successful extensions: 571 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -